SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011136 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011136
Domain Number 1 Region: 1-116
Classification Level Classification E-value
Superfamily Immunoglobulin 7.5e-25
Family V set domains (antibody variable domain-like) 0.0034
Further Details:      
 
Domain Number 2 Region: 70-187
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000012
Family C1 set domains (antibody constant domain-like) 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011136   Gene: ENSMODG00000008935   Transcript: ENSMODT00000011353
Sequence length 254
Comment pep:novel chromosome:BROADO5:3:432622243:432629239:1 gene:ENSMODG00000008935 transcript:ENSMODT00000011353 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GKTLSLQCQASGFLFNTSQLSWYLWVPGGAPLWLTSLDHRFSKVSGDRITSRREDTNSQI
FLQIKNLSLRDSGYYHCARRMGYGGDTDKLIFGSGTHVTVEPGPRDPLSPSVFVVRSQDA
VACLVSDFYPKEIDASLSSLGASVSAQAETVAPTIHGVYSAIQIGKAGDNDSVTCSVKHL
GKETHETAFFLSYLRVTQLSPVARRSYSMHSSHTPGNCLEPEQRNQIVLRVLGLRLLLMK
TVAINILFTIMALI
Download sequence
Identical sequences F7GL27
ENSMODP00000011136 13616.ENSMODP00000011136 ENSMODP00000011136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]