SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011205 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011205
Domain Number 1 Region: 20-122
Classification Level Classification E-value
Superfamily Immunoglobulin 1.54e-47
Family V set domains (antibody variable domain-like) 0.0000305
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011205   Gene: ENSMODG00000022581   Transcript: ENSMODT00000011422
Sequence length 141
Comment pep:known chromosome:BROADO5:Un:79397185:79397732:-1 gene:ENSMODG00000022581 transcript:ENSMODT00000011422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFGLKGIFILMILQGVHCDIQLVESGGDVRQPGGSLKLSCKASGFTFSSYYMSWVRQAP
GKGLEWVSRIDTAGSSTSYADSVKGRFTISRDNGNSLLHLQMNSLKAEDTATYYCARDTV
RESSERADKNLLIREFWWRMT
Download sequence
Identical sequences K7DYQ1
ENSMODP00000011205 ENSMODP00000011205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]