SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011284 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011284
Domain Number 1 Region: 575-716,766-942
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.29e-78
Family Protein kinases, catalytic subunit 0.0000000000726
Further Details:      
 
Domain Number 2 Region: 259-347
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000174
Family I set domains 0.078
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000011284
Domain Number - Region: 357-440
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000441
Family I set domains 0.057
Further Details:      
 
Domain Number - Region: 89-164
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00772
Family I set domains 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011284   Gene: ENSMODG00000009045   Transcript: ENSMODT00000011503
Sequence length 994
Comment pep:novel chromosome:BROADO5:4:298533795:298631590:-1 gene:ENSMODG00000009045 transcript:ENSMODT00000011503 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVFWLQGGRGQLRLLVVISAMAFGFIESQEPPLIKCMLIDNKISDSSIRTSSISMASDL
MKDLGCSLRPESTGVVYEAAETVEVDIFAAITLQVMLSIPGNISCTWFFKNNSTVCHPDF
DVQNRGIVSIVILKMTEIQAGEYLLSIQSEAMNYTVMFTVSVRSKLGKLGKPYFRKMENQ
NAVVCISESFPDPVIEWSFCSSQSKSCQRESQVVIRRKERVLDDLFGTDIWCCARNDLGE
KCTKLYTLDLNQNPGSTLPQLFIKEGEPLLIRCKAIYENYEFRLAWKLENRTLKEENLFK
MSTYSTNRTMIRILFAFVASVGRSDTGCYTCASSKHPNQSALVTVLEKGFINASNLSKDY
EIDEHEEFCFSVQFKAYPQVVCTWTFSQKSVPCKQSLKNGFSVSEFCDHKNQPGEYTFHA
ENGDAQFTKTFTLYVKRKPQVKMDTSANQASCYSDGYLPQSWTWKKCTDKSPNCTEITEG
IWNKRANREVFGQWTSSSTLNLSEQYQGLLVECCANNSLGSSCDSKLLSIPGFYYIIQDK
VSFYTTIGFCLLFIAVLLILISHKYRKQYRYESQLQMVQVTGSSDNEYFYVNFREFEYDL
KWEFPRENLEFGQVLGSGAFGKVMNATAYGISETGVSIQVAVKMLKEKSDSSEKDALMSE
LKMMTHIGSHENIVNLLGACTLSGPIYLIFEYCCYGDLLNYLRSKREKFHRTWTEVFKQH
NFSFYPTFHSSSRMPGLGGLHISQDIDLTSGFNGNSFYSEEEIEYENQKRLVEEEDFNVL
TFEDLLCFSYQVAKGMEFLELKSCVHRDLAARNVLVTHGKVVKICDFGLARDIMNDSNYV
VRGNVRLIARLPVKWMAPESLFEGIYTIKSDVWSFGILLWEIFSLGVNPYPGIPVDNNFY
KLIQSGFKMDQPFYATEEIYFIMQSCWSFDSKKRPSFPHLTSFLGCQLANAEVAMYQNIG
DGISKPLSSYQNRSSCSSHVSPGQPPPQAQDKDS
Download sequence
Identical sequences F6TMY2
ENSMODP00000011284 ENSMODP00000033356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]