SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011380 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011380
Domain Number 1 Region: 812-938,983-1156
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.11e-79
Family Protein kinases, catalytic subunit 0.00000000149
Further Details:      
 
Domain Number 2 Region: 662-753
Classification Level Classification E-value
Superfamily Immunoglobulin 1.78e-22
Family I set domains 0.0071
Further Details:      
 
Domain Number 3 Region: 238-339
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000122
Family V set domains (antibody variable domain-like) 0.061
Further Details:      
 
Domain Number 4 Region: 571-645
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000305
Family V set domains (antibody variable domain-like) 0.031
Further Details:      
 
Domain Number 5 Region: 355-434
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000486
Family I set domains 0.032
Further Details:      
 
Domain Number 6 Region: 424-471,509-556
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000052
Family I set domains 0.036
Further Details:      
 
Domain Number 7 Region: 124-225
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000114
Family I set domains 0.00013
Further Details:      
 
Domain Number 8 Region: 33-111
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000849
Family V set domains (antibody variable domain-like) 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011380   Gene: ENSMODG00000009128   Transcript: ENSMODT00000011600
Sequence length 1341
Comment pep:novel chromosome:BROADO5:4:298925832:299127239:-1 gene:ENSMODG00000009128 transcript:ENSMODT00000011600 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCGWMVTGAALSVLLGCLLLTGSSSGSKLKGPELSLKGTQYVMQADQTLYLKCRGEVAHS
WSLPKTVSKESKRLSITTSVCGRNGKQFCSTLTLARAQANHTGYYSCRYLSTPVSKKKRT
ESTIYIFINDTGSPFVEPHSIMPETVLMAGGQEMIIPCRVSAPDITVTLKKFQIPDVKTL
IPDGKTIIWDNKRGFIIPKPTYIFIGLLSCETTVNGHLYSTNYLTYRQDNTILDVQLSTP
NPIKLLKGQTLVLNCTVTAAWNTRVQMTWNYPGEVINRASITPRFDSSNSQANVFYSTLI
IDKVQSKDKGLYTCQVKSGPSFRSANTTVHVYEKPFITVKHRKQQVLETIAGKRSYRLSM
KVKAFPSPEVVWLKNGLPATEKCARYVVHGYSLIIKDVAEEDAGDYTILLSIKQSKIFKN
LTTTLIVNVKPQIYEKAVSSFPDPNLYPVGSQQSLTCTIYGVPQPTIKWIWHPCSQNHSK
TRYDFCSTSDRSFNLDASSNIGNRIQSITQRMAVIEGKNKIASTLVVADTKASGIYSCVA
SNKVGHVERNISFYVTDVPNGFHVNLEKMPAEGEDLKLSCTVSKFLYRDITWILLRTVNN
RTMHHSISKQKMAVTKEYSITLNLTIKNVSLEDSGTYACRARNIYTGEEILQKKEVTIRD
QEAPYLLRNLSDQIVAISNSTTLDCQAKGVPEPQITWFKNNHEIQQEPGIILGPGSSTLF
IERVTEEDEGFYRCKATNQKGSVQSSAYLTVQGTSDKSNLELITLTCTCVAATLFWLLLT
LFIRKLKRTSSEIKTDYLSIIMDPDEVPLDEQCDRLPYDASKWEFARERLKLGKSLGRGA
FGKVVQAAAFGIKKSPTCRTVAVKMLKEGATASEYKALMTELKILTHIGHHLNVVNLLGA
CTKHGGPLMVIVEYCKYGNLSNYLKSKRDFFFLNKDAALQTEPKKEKESELEQGKKQRLD
SVTSSESFASSGFQEDKSLSDVEEEEEDPDDFYKQPITMEDLISYSFQVARGMEFLSSRK
CIHRDLAARNILLSENNVVKICDFGLARDIYKNPDYVRKGDTRLPLKWMAPESIFDKIYS
TKSDVWSYGVLLWEIFSLGASPYPGVQIDEDFCSRLKEGTRMRAPEYATSEIYQIMLDCW
HKDPKERPRFSELVEKLGDLLQANVQKDGKDYIPLNNILTGNNGFAYPTPAFSEPYFKED
SSTPKFNSGSSDDVRYVNAFKFTHPQRVKTFEELSPKTTTVFEDYQADSGMVLAPQELKR
FTWAESKPKSTLMFGLKVTSRSKESGLSERTKPNFCHSSCGHVNEVNRRFTYDNSELERK
ISCCSPPPDYNSVVLYSNPPV
Download sequence
Identical sequences F7EY52
XP_007495324.1.35504 ENSMODP00000011380 ENSMODP00000011380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]