SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011565 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011565
Domain Number 1 Region: 228-328
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000174
Family I set domains 0.053
Further Details:      
 
Domain Number 2 Region: 121-219
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000065
Family I set domains 0.0041
Further Details:      
 
Domain Number 3 Region: 27-102
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000456
Family I set domains 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011565   Gene: ENSMODG00000009261   Transcript: ENSMODT00000011785
Sequence length 331
Comment pep:novel chromosome:BROADO5:1:345099068:345112019:1 gene:ENSMODG00000009261 transcript:ENSMODT00000011785 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RARKSRPQVETQPPGALVPSPPSILIQVVGKGQFQKVGDSLSLRAGDALELRCRGKSVHW
RFPVYLEEEGEGRLRIKHFTQYSQLLVMNSTIADTGEYSCWSRYCQDSECRDVKDRTNKT
FVFFTDQQELFVPTEDYYEVVQLRTNQPTLLPCQVTSPEAQVTLHREFPPEEVAVDGVDI
SFDAKKGFTIHRPRASLAGSLFCMASLGGIHQISTKYILIYINYPSSSPKPTIQASATSV
PLGEHFNVTCTALGEPEITVDFTWEYPGQLMGRPPYVSECSTVVRRAGQVQQEWESVLYV
EEARAKDQGIYTCRATNLQGTSTASTRIRIL
Download sequence
Identical sequences F7DB56
13616.ENSMODP00000011565 ENSMODP00000011565 ENSMODP00000011565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]