SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011571 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011571
Domain Number 1 Region: 519-601
Classification Level Classification E-value
Superfamily Immunoglobulin 1.25e-16
Family I set domains 0.0032
Further Details:      
 
Domain Number 2 Region: 415-491
Classification Level Classification E-value
Superfamily Immunoglobulin 1.83e-16
Family I set domains 0.011
Further Details:      
 
Domain Number 3 Region: 336-422
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000143
Family I set domains 0.03
Further Details:      
 
Domain Number 4 Region: 613-681
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000157
Family I set domains 0.017
Further Details:      
 
Domain Number 5 Region: 227-328
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000409
Family V set domains (antibody variable domain-like) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011571   Gene: ENSMODG00000009263   Transcript: ENSMODT00000011791
Sequence length 797
Comment pep:novel chromosome:BROADO5:2:102285475:102429877:-1 gene:ENSMODG00000009263 transcript:ENSMODT00000011791 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQGLLAAQTQKQNKNRQQSPNPSHSGSRSQSWSHSHRASPSPSPPRTHNRTAHCSNHHSS
SHNGPLNHSHHSRNTNHHPSNTCPTRRKATGLAKRKAKKGRSPYRREKQADRRAPALKRK
IPVLWSRESSLHRDRTRLCGNHTAFSLESSKDNSRDTPTEETPCWSGEQRFLGRREAVTP
SGQCRPMERPSEASQSKGSTWKGLLIITASILSCWSQPTSAQDLPVVPEPAYGKEGDNVT
LVVRGFSGTPLSYTWYTKLSAEDPKDTEMVMYSVINGSQTPNDIRQRVFPNGSLLIPNLV
LNDTKYYTVQMVDTIGNILRGGAQLTVYGPLSRPIINSPNMAPVENKDFSLTCQAEGQID
TYRWFINESAPTGERIQLSQDNKTLTINNITRKDEGPYVCQIENLFYSNRSDPFTLNVTY
GPDTPTITPTFDHYPIGADITLNCSAESNPPAQFTWFHNGQNLSDSAILSITNVSLNHTG
TYTCHASNSYTGLNSTKDKNITIYENLMKPNITINSASNIMENDTVVLTCNTENGNNVGT
RWYFKNEKLILNDRMNLSQDNKTLTIMPVKGEDNGDYQCEIWNPIGTNRSDSFHLVVIYG
PEEIKLYPNSVNGQIEVTFNENLTLGCEAKSQPPAQYTWQINGSSISGNSGNNYTIYQAS
WKHEGIYTCMAVNNVTKATISTQNTVKVVEKMDPSGGGSSLSGGAIAGIVIGVLAGVALI
GALVYCLFFRKSAGASDHHPTEHKSSAPNHSHLKSDRPPNGTEEVSYASVNFNAQKSSAT
VQAPTPTETIYSEIKKK
Download sequence
Identical sequences F7DAN1
ENSMODP00000011571 ENSMODP00000011571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]