SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011723 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011723
Domain Number 1 Region: 95-353
Classification Level Classification E-value
Superfamily L domain-like 5.85e-49
Family Ngr ectodomain-like 0.0078
Further Details:      
 
Domain Number 2 Region: 396-706
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.46e-42
Family Rhodopsin-like 0.00088
Further Details:      
 
Domain Number 3 Region: 27-64
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011723   Gene: ENSMODG00000009382   Transcript: ENSMODT00000011944
Sequence length 714
Comment pep:novel chromosome:BROADO5:4:303410406:303492534:1 gene:ENSMODG00000009382 transcript:ENSMODT00000011944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFLLRLVILLDVKDFILTQDSSVSPSCQKGFFPCGNLTKCLPRAFHCDGVNDCGNGADE
ENCGDNSGWASIFDTIHGNPNNMDLSQECYLQQYPQCCACKETELECINVNLKSVPLVSS
NVTLLSLKKNKIHILPDEVFTQYTEVKKIFLQYNCIKYISRKAFIGLHKLQMLYLSHNCI
TSLRPGVFKDLHELSWLILDDNPITRISQQLFTGLNSLFFLSMINNHLEALPKEMCKHMP
HLNWVDLEGNQIKSLMNSTFLACDELTVLFLPRNQIDFVPDKTFSSLKNLGELDLSNNMI
MDLPHHIFKDLKHLQKLNLSYNPLPYLDEDHFKSLKYLQSLDLEKIEIPNINTRILAFPN
LRGLSIYYFKNFRYCSYAPHVRICIPLTDGISSFEDLLANNILRIFVWVIAFITCFGNLF
VICMRTFIRAENKTHAMSIKILCCADCLMGVYLFFVGFFDIKYRGQYQKYALLWMESLQC
RLMGFLAMLSTEVSVLLLTYLTLEKYVVIVFPFSNIRPGKHQTLIILVCIWIAGFLIAII
PFWSEEFFGNFYGKNGVCFPLYDQTEDFRSKGYSLGIFLGVNLLAFLIIVFSYISMFCSI
QKTALQTSDMRIPIRRDVALANRFFFIVFSDAICWIPVFVIKTLSLFQVEIPDTITSWIV
IFFLPINSALNPILYTLTTSFFKDKLKQLLHKHRRRSIFKSEKKSLSTSIVWTD
Download sequence
Identical sequences F7CPT6
ENSMODP00000011723 ENSMODP00000011723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]