SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011749 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011749
Domain Number 1 Region: 31-134
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000142
Family V set domains (antibody variable domain-like) 0.065
Further Details:      
 
Domain Number 2 Region: 157-217
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000367
Family C1 set domains (antibody constant domain-like) 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011749   Gene: ENSMODG00000009405   Transcript: ENSMODT00000011971
Sequence length 333
Comment pep:novel chromosome:BROADO5:2:164786484:164827995:-1 gene:ENSMODG00000009405 transcript:ENSMODT00000011971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANLLQKWLLFFLFYLFTELYASGEDLDSQMLTGVLGESAILPLTIPKEKQITYILWTSK
RSLAIIEMGKEGNANKTTIIDPHYKERVNFLKQSYNYAMQINHLKMEDAGSYQAEITIAN
ITEPMKKMFTLHIHERLTEPKIIPSLKFNDNGTCLINLTCSVEQIRENASYSWMSNRQGA
NISTRGPILTLNWKPGDHDLNYTCIARNPVSNSSCTILAKELCAGIEHGTHCFRVLYIVV
PTILVFLFISGLSFWHIQKKKEKEADIRDNECSMYDSISILNPDETETAEYVTVNSFKKN
IQESLEAPNTLYATVQNTTKMDKSEILERTQNL
Download sequence
Identical sequences F7C672
ENSMODP00000011749 ENSMODP00000011749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]