SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011807 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011807
Domain Number 1 Region: 131-213
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000213
Family I set domains 0.031
Further Details:      
 
Domain Number 2 Region: 26-128
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000026
Family V set domains (antibody variable domain-like) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011807   Gene: ENSMODG00000009448   Transcript: ENSMODT00000012030
Sequence length 255
Comment pep:novel chromosome:BROADO5:2:164960104:164981023:1 gene:ENSMODG00000009448 transcript:ENSMODT00000012030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKPHLWLLLFCLLLGSTASRENNAPVVVTGILGESAILPADIPDKNKIDNINWASRTPV
AVVTPEGTSVNIITTHLNYKGRLNVSSKTYDLQINHLKMEDAGFYRADINLKTSSTSTTI
TKNYTLQIYRRLEQPKITLNALASENNTCNITLTCSVEIREAVKYEWTPLGEQTAESDGK
SRLFIFQASGDVPKNYTCLATNPVSKNSQSILVKNSCAGTLMISGPPWYALISVLEMLVI
FSLAGVGFYLWHKIK
Download sequence
Identical sequences F7FZL3
ENSMODP00000011807 ENSMODP00000011807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]