SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011809 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011809
Domain Number 1 Region: 10-112
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000421
Family V set domains (antibody variable domain-like) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011809   Gene: ENSMODG00000009452   Transcript: ENSMODT00000012032
Sequence length 149
Comment pep:novel chromosome:BROADO5:2:165024323:165026019:1 gene:ENSMODG00000009452 transcript:ENSMODT00000012032 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STASRENNAPVVVTGILGESAILPADIPDKNKIDNINWASRTPVAVVTPEGTAVNIITTH
QNYKGRLNVSSKTYDLQINHLKMEDAGFYRADINLKTSSTSTTITKNYTLQIYRRLEQPK
ITLNTIASENNTCNITLTCSVEIGDAVKY
Download sequence
Identical sequences F7FZK6
ENSMODP00000011809 ENSMODP00000011809 13616.ENSMODP00000011809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]