SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011870 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011870
Domain Number 1 Region: 5-113
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000141
Family Fibronectin type III 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011870   Gene: ENSMODG00000009502   Transcript: ENSMODT00000012093
Sequence length 331
Comment pep:novel chromosome:BROADO5:1:584187478:584191805:-1 gene:ENSMODG00000009502 transcript:ENSMODT00000012093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEMLLSTPHSIEINNITCDSFRISWAMEGSDLERVTHYFIDLNKKENKNSNKFKHRDVPT
KLVAKAVPLPMTVRGHWFLSPRTEYSVAVQTAVKQSDGEYLVSGWSETVEFCTGDYAKEH
LAQLQEKAEQIAGRMLRFSVFYRNQHKEYFQHARTHCGNMLQPYLKDNSGSHGSPTSGML
HGVFFSCNTEFNTGQPPQDSPYGRWRFQIPAQRLFNPSTNLYFADFYCMYTAYHYAILVL
APKGSQGDRFCRDRLPLLDIACNKFLTCSVEDGELVFRHAQDLILELIYTEPVDLSLGTL
GEISGHQLMSLSTADAKKDPSCKTCNISVGR
Download sequence
Identical sequences F7F9L7
ENSMODP00000011870 ENSMODP00000011870 13616.ENSMODP00000011870 XP_007476535.1.35504 XP_007476536.1.35504 XP_016277785.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]