SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011877 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011877
Domain Number 1 Region: 472-546
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000419
Family I set domains 0.029
Further Details:      
 
Domain Number 2 Region: 378-460
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000186
Family I set domains 0.0058
Further Details:      
 
Domain Number 3 Region: 258-352
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000692
Family V set domains (antibody variable domain-like) 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011877   Gene: ENSMODG00000009507   Transcript: ENSMODT00000012100
Sequence length 586
Comment pep:novel chromosome:BROADO5:2:102459035:102562893:1 gene:ENSMODG00000009507 transcript:ENSMODT00000012100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQGLLAAQTQKQNKNRQQSPSPSHSGSGSQSWSHSYSRSRSRSWSHSGSRSRSRSRSHSR
SQSQSWSHSHSASPSPSPPRTSNKTALCSNHHSSSHARPLTHSHHSHNANHHLSNTCPTR
RKATGLAKRKAKKGRSPYRRKKRADRRAPALKRKIPVLWSRESSLHRDRDRLWGSHTAFS
LESSRDSSRETPKDETPYWVGEQRFLGRREAVTPDEQCRPMERPSEASQSRGSTWKGLLI
ITASILSCWSQPTSAWELTIVPEPTYVAAGETQVLNFKGFNGTAVKYVWNYKYVESDTNY
NLLYEYNVLTGQQHPSQGRVHVSPNGSLVIPRANEYDVRYYILEVFDNASHVYRGQFGLF
LYEKNLKKPDLTVNRKSPVTENTYVYFSCTSHNKNAAKVRWRFQNKILILNKRMGLYQDN
ETLAINHVKAEDNGGFQCEVWNPAASRLSDPINLTVIYGPEEIKLYPNSVNGSINVTSKE
NLTLACEATSLPPAQYTWQFNGSSISENSGHNYTIYHASWENAGTYVCLAMNNVTNATIS
ANITVRLIENKAQKMSGWVIAGILAAILTATLVIVSFIYRRLIQLQ
Download sequence
Identical sequences F7F9J6
ENSMODP00000011877 XP_016285519.1.35504 ENSMODP00000011877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]