SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011916 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011916
Domain Number 1 Region: 19-134
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000438
Family V set domains (antibody variable domain-like) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011916   Gene: ENSMODG00000009530   Transcript: ENSMODT00000012140
Sequence length 206
Comment pep:known chromosome:BROADO5:1:716608305:716615924:1 gene:ENSMODG00000009530 transcript:ENSMODT00000012140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RIWLQVLPRSTRSIFGVPALSQSPETLLVQTDKQARLICDIKLPSINYGIYWFRLIGSPH
SDSLSYEFLLQSEARGSCTYGKGVNSTHVTASRESSKSTLLLQRAKPSDSGIYICTIITS
PSLQSGSGTRVKVVDALPTTPTPTKKTTTKRKMCPKKFPGATQQDGPFCSVLLLSLLVGC
ILILLISLIVILRMNCKLFFLTNGTK
Download sequence
Identical sequences F7C4A1
ENSMODP00000011916 13616.ENSMODP00000011916 ENSMODP00000011916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]