SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011960 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011960
Domain Number 1 Region: 98-179
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000301
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 278-358
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000016
Family I set domains 0.015
Further Details:      
 
Domain Number 3 Region: 447-528
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000633
Family I set domains 0.016
Further Details:      
 
Domain Number 4 Region: 975-1055
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000014
Family I set domains 0.019
Further Details:      
 
Domain Number 5 Region: 623-704
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000112
Family I set domains 0.021
Further Details:      
 
Domain Number 6 Region: 799-880
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000148
Family I set domains 0.023
Further Details:      
 
Domain Number 7 Region: 545-635
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000251
Family I set domains 0.019
Further Details:      
 
Domain Number 8 Region: 369-457
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000526
Family I set domains 0.011
Further Details:      
 
Domain Number 9 Region: 897-985
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000695
Family I set domains 0.016
Further Details:      
 
Domain Number 10 Region: 724-806
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000001
Family I set domains 0.025
Further Details:      
 
Domain Number 11 Region: 196-281
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000741
Family I set domains 0.013
Further Details:      
 
Domain Number 12 Region: 18-105
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000013
Family I set domains 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011960   Gene: ENSMODG00000027582   Transcript: ENSMODT00000012184
Sequence length 1068
Comment pep:novel chromosome:BROADO5:Un:34022747:34156873:-1 gene:ENSMODG00000027582 transcript:ENSMODT00000012184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HSHFLSILCTAPLSKPTILTSNNTAVETKDFSLTCNATGQIHAYKWFINGVAPAGRRIQL
SPDRRTLTLQSLKRRVNKGPCVCEIENPFYRNRSDPFTLDVAYGPDIATIVHSPDEYPTG
ANITLSCVADSNPAAQFTWLHNGQSVSNSATFSIIASLSDAGTYTCTASNSFTGLTRTAT
KNIIIYAPLSKPTILTSNNTEVETKDFSLTCYATGQIHAYKWFINGVAPAGRRIQLSPDR
RTLTLRSLTRSFNKGPYVCEIENPFYHNRSDPFTLDVAYGPDIATIVHSADEYPTAANIT
LSCVADSNPAAQFTWLHNGQPVSNSATFSIIASLSDAGTYTCTASNSFTGLTCTATKNII
IYAPVSKPTIVTSNITAVETKDFSLTCQATGQIHAYQWFINGVAPAGSRIQLSPDKRTLT
LSRLTRRDNKGPYECEIRNPFSSNRSDPFTLDVAYGPDFATIDHISDQFATGINVTLSCV
ADSNPPAQFTWLQNGQPLSNSASFSIITSLNDIGNYTCIATNSFTGLTRTANKTLMIYAP
LSKPTIVTSNITAVETKDFSLTCQATGQIHAYQWFINGVAPAGSRIQLSPDKRTLTLSRL
TRRDNKGPYECEIRNPFYSNRSHPFTLDVAYGPDIATIDHISDQFATGINVTLSCVADSN
PPAQFTWLQNGQSVSNSASFSIITSLNHIGNYTCIATNSFTGLTRTANKTLMIYAPLSKP
TIVTSNITAVETKDFSLTCQATGQIHTYQLFINGVAPAGSRIQLSPDKRTLTLSRLTRRD
TKGPYECEIRNPFYSNRSDPFTLDVAYGPDIATIDHISDQFTTGINVTLSCVADSNPPAQ
FTWLQNGKSVNNSASFSIITSLNHIGNYTCIATNSFTGLTRTANKTLMIYAPVSKPTIVT
SNITAVETKDFSLTCQATGQIHTYQWFINGVAPAGSRIQLSPDKRTLTLSRLTRRDNKTP
YECEIRNPFYSNRSDPFTLDVAYGPDIATIDRISDQFSTGNNVTLSCVADSNPPAQFTWL
QNGQSVSNSASFSIITSLNHIGNYTCIATNSFTGLTRTANKTLMIYGE
Download sequence
Identical sequences M9MMH4
ENSMODP00000011960 ENSMODP00000011960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]