SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011962 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011962
Domain Number 1 Region: 1085-1142,1185-1252
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000306
Family I set domains 0.017
Further Details:      
 
Domain Number 2 Region: 725-806
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000576
Family I set domains 0.014
Further Details:      
 
Domain Number 3 Region: 1254-1332
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000218
Family I set domains 0.015
Further Details:      
 
Domain Number 4 Region: 546-627
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000972
Family I set domains 0.01
Further Details:      
 
Domain Number 5 Region: 24-110
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000127
Family I set domains 0.032
Further Details:      
 
Domain Number 6 Region: 1605-1687
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000176
Family I set domains 0.071
Further Details:      
 
Domain Number 7 Region: 1423-1507
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000255
Family I set domains 0.025
Further Details:      
 
Domain Number 8 Region: 374-447
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000306
Family I set domains 0.011
Further Details:      
 
Domain Number 9 Region: 196-276
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000544
Family I set domains 0.016
Further Details:      
 
Domain Number 10 Region: 1783-1863
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000176
Family I set domains 0.028
Further Details:      
 
Domain Number 11 Region: 895-976
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000331
Family I set domains 0.021
Further Details:      
 
Domain Number 12 Region: 1875-1961
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000652
Family I set domains 0.014
Further Details:      
 
Domain Number 13 Region: 610-715
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000738
Family I set domains 0.012
Further Details:      
 
Domain Number 14 Region: 1697-1785
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000944
Family I set domains 0.011
Further Details:      
 
Domain Number 15 Region: 1314-1425
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000129
Family I set domains 0.011
Further Details:      
 
Domain Number 16 Region: 990-1081
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000161
Family I set domains 0.012
Further Details:      
 
Domain Number 17 Region: 817-905
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000202
Family I set domains 0.016
Further Details:      
 
Domain Number 18 Region: 1521-1609
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000034
Family I set domains 0.013
Further Details:      
 
Domain Number 19 Region: 258-372
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000383
Family I set domains 0.017
Further Details:      
 
Domain Number 20 Region: 116-201
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000741
Family I set domains 0.0056
Further Details:      
 
Domain Number 21 Region: 434-540
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000018
Family I set domains 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011962   Gene: ENSMODG00000027970   Transcript: ENSMODT00000012186
Sequence length 1979
Comment pep:novel chromosome:BROADO5:2:102590983:103045328:1 gene:ENSMODG00000027970 transcript:ENSMODT00000012186 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCEMVNIVSHVNSDGFILDVAYGPDSMTILPAADRYNVGEHIQLTCSAQSCNPPAQLTWL
QNGQPVSNSGTFSATAALNHAGNYTCVAYNSLTGIRHSQSMNIIIYGPLSKPIILTSNNT
AVETKNFSMTCQPSGAIVTTRWFINGLPAGGNRIQLSPDKSILTIHNLSRTENKGPYECE
TENTVSVNKSDPFTLDVTYGPDNATIAHLSNVYPTGANIIFNCSADSHPPVQFTWLHHGQ
QIRNSPIFSIIASVGDAGTYTCTASNSLTGLTRTASKTLRIYAPLSKPTILISNKTAVET
KDFSMTCQATGQIEAYQWFINGLAPVGSRIQLSQDKRILTLPRLTRRDNQGPYVCGIENP
LFSSMSDPFTVNVTYGPDNATIVRTPDVYPTGANIIFNCSADSNPPAQLIWLRNGQQIRN
SSIFSIIASLSDAGTYTCSASNSLTGLTRTSNKTIRIYAPLSKPTILISNKTAVETKDFS
MTCQATGQIEAYQWFINGLAPVGSRIQLSRDTRILTLPRLTRRDNQGPYVCGIENALFSS
MSDPFILDVTYGPDIATIVHTPDVYPTGANIIFNCSADSNPPAQFIWLQNGQRVSNSATF
SIIASLSDAGTYTCTASNSLTGLTRTATKNITIYAPLSKPTIVTSNITAVETKDFSFTCQ
ATGQIHTYQWFINGLVAAGSRIQLSPDKRTLTLPRLTRRDNKGPYVCEIENPLFRNRSDP
FPLNVTYGPDIATIVHSANEYPTGANITLSCVADSNPAAQFTWLHNGQPVSNSATFSVIA
SLSDAGTYTCTASNSFTGLTRTATKNIIIYAPLSKPTIVTSNITAVETKDFSLTCQATGQ
IHTYQWFINGVAPAGSRIQLSPDKRTLTLSRLTRRDNKVPYECEIRNPFYSNRSDPFTLD
VAYGPDIATIDHISDQFATGINVTLSCVADSNPPAQFTWLQNGQSVNNSASFSIITSLNH
IGNYTCIATNSFTGLTRTANKTLMIYAPLPKPIIVTSNNTAVETKDFSLTCNATGQIHTY
RWFINGLAPGGNRIQLSQDKRILTIRSLTRRENKGPYVCEIENPFFMDSSDPFKLNVTYG
PDNATIVHTVNEYPVGANITLSCSANSNPAAQFTWLQNGQSVSNSATFSFIATLNHAGTY
TCSASNSFTGLTRTATKNLIIYAPLSKPTILTSNITAVETKDFSFTCQGIGQIHAYWWLI
NGVAPAGGRIQLSPDKRTLTIRSLTRRENKGPYVCGIENPLFSNRSDPFTLDVAYGPDIA
TIVHTPDVYPTGANITLSCSATSNPPVQFTWLQNGQPVSNSATFSFIASLNHAGTYTCTA
SNAFTGLTRNATKNLIIYAPLSKPTIVTSNITAVETKDFSMTCQATGQIHAYRWFINGVA
PAGSRIQLSPDKKILTIPNLTRRDNKGPYVCEIENPLFSNRSDPFTLDVAYGPDIAMIVR
TQDVYPTGANITLSCSAISNPPVQFTWLQNGQPVSNSATFSFIASLNRAGTYTCIASNSF
TGLAHTANKTLIIYAPLSKPTILTSNRTAVETKDFSLTCQGTGQIHAYRWFINGLAPSGS
RIQLSPDKKILTIGNLTRRENKGPYVCEIENPLFRNRSDPFTLNVTYGPDIATIAHSVDE
YPIGANITLSCSAVSNPPVQFTWLHNGQPVSNSATFSFIASMTLSGTYTCNAANSLTGLT
RSATKNVIIYAPLSKPTIVTSNITAVETKDFSFTCQATGQIHTYRWFINGLAPSGSRIQL
SPDKRTLTIRNLIRTENKGPYECEIQNPFYSNRSDPFTLDVAYGPDTATIVRTVDEYPIG
ANITLSCSSKPNPPVQFTWLHNGQPVSNSATFSFTASLSLAGTYTCSAANSFTGLTRTAT
KNVIIYAPLSTPIIVTSNNTAVETKDFSFTCQATGQIHTYRWFINGRAPAGSRIQLSPDK
RTLTIRNLTRTENKGPYVCEIKNPFYSNRSDPFTLDVAYGPDTATIVRTVDEYLLGNIT
Download sequence
Identical sequences M9MMH5
ENSMODP00000011962 ENSMODP00000011962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]