SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012119 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012119
Domain Number 1 Region: 35-234
Classification Level Classification E-value
Superfamily L domain-like 6.8e-36
Family Ngr ectodomain-like 0.0053
Further Details:      
 
Domain Number 2 Region: 252-338
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000163
Family I set domains 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012119   Gene: ENSMODG00000009694   Transcript: ENSMODT00000012343
Sequence length 396
Comment pep:novel chromosome:BROADO5:1:21820191:21839986:1 gene:ENSMODG00000009694 transcript:ENSMODT00000012343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQLHLLWLAGFLGSVSGCPEVCDCGEKYVFQIADCAYRDLQSVPPGFPANVTTLSLSAN
RLGDLEAGAFEEVPLLQSLWLAHNEIRVVAPGSLTSLVYLKSLDLSHNLISNFSWNDLHN
LSALQLLKMDSNELAVIPRDAFKNLGDLRSLQLNHNRFLTLVDGTFEGLTSLSHLQINDN
PFNCTCGLLWLKVWAVATAVSIPEQDNIACSSPPFLKGIPLGRLPPLHCAPPTVQLTYQP
NQDGAELRDGFVLALHCDTDGQPPPEVQWRIQTPGGKVEITSPNVGPDGRVPGVAGSPQP
RFQAFANGSLLIPGFGKQEEGTYSCRATNELGSAEGSVNVALASPGEASEDALGRKFHGK
AGGGERRRKGFVKERHRDQRRERPKKKREGGPKGLD
Download sequence
Identical sequences F6YBD7
ENSMODP00000012119 ENSMODP00000012119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]