SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012142 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012142
Domain Number 1 Region: 335-426
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000111
Family I set domains 0.0025
Further Details:      
 
Domain Number 2 Region: 439-513
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000989
Family I set domains 0.018
Further Details:      
 
Domain Number 3 Region: 224-327
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000414
Family V set domains (antibody variable domain-like) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012142   Gene: ENSMODG00000027441   Transcript: ENSMODT00000012367
Sequence length 556
Comment pep:novel chromosome:BROADO5:4:369277660:369381080:1 gene:ENSMODG00000027441 transcript:ENSMODT00000012367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGLLVSQTQKRKKNRKQSPCSSCRQRQRQSWSHSPSASPSPFPPRTPNGTAHSSNHHSS
SHAQAHTHSYYSHNSNHHHSNSCPNRKKATGLAKRKAMKGQSPNRRKKRADRRAPVLKRK
IPVLWSRGSSLHRDRDRLWGSHTAFSLESSRDSSRETPTDETPCWAGEQRFLGRTEAVTP
GGQCRPMERPSEASQSRGSTWKGLLIITASILSCWIQPTSAQDITVVPQPTYVQESDNVI
LNIQGYTGSAREYVWYRKKSAQDPGRVKIVTYNPATKYLSPSNSRQRVFANGSLIIPNLV
GIDDAYYEVQINDSSSQILTGGALVTVYDKYMRKPTVTIQSAGHIVQNDSAVMKCNSRHN
DLSQIRWYFQNKKLILNDRRTLPSNNKTLMITPVKREDNGAYQCEVWNPLNARKSDPFNL
SIIYGPEEIKILPKHVHGQIEVLLNKKLTLECQASSEPPAQYTWQVNGSSRAGNSGNIYA
ISKLSWGHSGTYTCMAMNSITNTAISKNIIVRVYEPSGGSIRAGQIVAGIVIGVLAGVAL
MVALIYYMVIGESSGE
Download sequence
Identical sequences F6XT90
ENSMODP00000012142 ENSMODP00000012142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]