SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012154 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012154
Domain Number 1 Region: 25-116
Classification Level Classification E-value
Superfamily Immunoglobulin 1.04e-36
Family V set domains (antibody variable domain-like) 0.000054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012154   Gene: ENSMODG00000009835   Transcript: ENSMODT00000012379
Sequence length 118
Comment pep:known chromosome:BROADO5:1:715725567:715726178:-1 gene:ENSMODG00000009835 transcript:ENSMODT00000012379 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMGSQAQLFCLLLLCIPGSRGAVGLTQSPASLAVSLGESVSLSCRASQSVSNHINWYQQP
PGQSPRLLIYYASNLHSGVPARFSGSGSGTDFSLTISAVEPEDVADYYCQQVNSWPLT
Download sequence
Identical sequences F6XSM2
ENSMODP00000012154 ENSMODP00000012154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]