SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012168 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012168
Domain Number 1 Region: 561-695,770-900
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.74e-57
Family Protein kinases, catalytic subunit 0.000000226
Further Details:      
 
Domain Number 2 Region: 319-404
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000604
Family I set domains 0.043
Further Details:      
 
Domain Number 3 Region: 212-301
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000154
Family I set domains 0.054
Further Details:      
 
Domain Number 4 Region: 22-97
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000197
Family V set domains (antibody variable domain-like) 0.095
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000012168
Domain Number - Region: 417-517
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000601
Family C2 set domains 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012168   Gene: ENSMODG00000009737   Transcript: ENSMODT00000012393
Sequence length 1061
Comment pep:novel chromosome:BROADO5:1:342957445:343027442:-1 gene:ENSMODG00000009737 transcript:ENSMODT00000012393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSVFSGWLWLLLLLPEAKALKITPHGSEFILNLSSTFVLTCTGDAPVAWEKIPQQTPPP
VLEAQDGTFSSILTLTNVTGLDTGEYICSYNGSQGLEFGGQKRVYIFVPDPSVGFLPVDP
EELFIFFTGDSETTIPCRVTDPKLVVTLHEKKVDVSLPVPYDHQRGFTGPFEDKTYICKT
IIDEKEVDSEAYYVYRIQVSSINVSVNAVQSVVRKGENITVLCIVKGNEVVNFDWTYPRM
ESKRLVEPVTDFLSGLEYDIRSILHIPSAELGDSGTYVCNVSESYNGHRDMKGVNITVID
KGFVRFLGELDDLEFAELHKSRTLQMFIEAYPAPTIVWLKDNQTLGSGTASEISISTRNL
SETRYVSELTLVRVKVNEGGYYTLRAFHDDAADSFSFQLQINVPAKVIDLSESHPSSGEQ
LLTCRSQGMPQPVLNWFSCNDFKRCPRDVLPTFLGNSSSEEAQLETNVTYWEQEKLFEVV
SILSFQRVDQPLSVICEVHNLLGRDSKEVTIVPHSLPFKVVVISAILALVVLTIISMVIL
IILWQKKPRYEIRWKVIESVSSDGHEYIYVDPMQLPYDSSWELPRERLVLGRTLGSGAFG
QVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQALMSELKIMSHLGPHLNIVNLLGACT
KGGPIYIITEYCRYGDLVDYLHRTKHTFLQHCPEKGGPYQSSEVLDHPEHQLHRQTSLSG
ESDGGYMDMRKDDCVDYVPMLGMKGEIMYVDIESSNYSSPYDSYAPSVPERSYRTTLINE
SPILSYMDLVGFSYQVANGMEFLASKNTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWE
IFTLGGTPYPELPMNEQFYNAIKRGYRMAKPTHASEEIYEIMQKCWEEKFEIRPSFSQLV
ILMEGLLGEGYKKKYQQVDEEFLRSDHPAILRTRAQLPVFSGPRGPLDTSSVLYTAVQQN
EGDNDYIIPLPDPKPEGPDAAPLESSHSLASSTLNEANTSSTISCDSPLELQEELDPESE
EPETEPKPEPKSEPEPEPEPEPRPILDHQDQGQPEMEDSFL
Download sequence
Identical sequences F6XAD2
XP_007473926.1.35504 XP_007473927.1.35504 ENSMODP00000012168 ENSMODP00000012168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]