SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012185 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012185
Domain Number 1 Region: 41-228
Classification Level Classification E-value
Superfamily L domain-like 9.72e-41
Family Ngr ectodomain-like 0.0053
Further Details:      
 
Domain Number 2 Region: 255-345
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000142
Family V set domains (antibody variable domain-like) 0.035
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000012185
Domain Number - Region: 493-540
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000355
Family Fibronectin type III 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012185   Gene: ENSMODG00000009748   Transcript: ENSMODT00000012410
Sequence length 715
Comment pep:novel chromosome:BROADO5:1:21765170:21767317:1 gene:ENSMODG00000009748 transcript:ENSMODT00000012410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPASVLGLWLAWALLGVAQGCTEPCACVDKYAHQFADCAYKDLQEVPSGLPANVTTLSLS
ANKITSLRQGAFAEVTQVTSLWLAHNEISAIEPGALAVLVQLKNLDISHNQIVDFPWADL
RNLSALQLLKMNNNRMAALPADAFRNLRDLRSLRINNNHFSFIAEGTFDALTSLSHLQIY
NNPFDCTCRLLWLKAWAENTLISIPERESITCASPPALKGVPLGSLPALQCAPPTVRLSY
QPNVDGGEFQDGLALALHCVVTGHPQPQIQWRIETAGGALLIERPNASEAGEEMPSISPQ
RFLAFSNGTLLIPHLSKKEEGTYTCRADNELGSNETSVSVAVAGPQKYPPTSPRGELPGL
GSKGSGGDRKASGKGYGNSVLTSKGEERTKGRGAWGGQGRASAARTPGVPEDVEVEAEAE
DEDPFRPPPFERRCGQGDPTMYVSNHAFNQSADLKPHAFDLGVIALDVAEREAKVQLTPF
ATRPEKRHLRMLYLCAEGGHSVVQWSRIEEGVNSYWFQGLSPGTNYSVCLTYVGEACQVQ
VVFTTKKEVPSLVIIVVVSVFLLALATVPLLGATCCHLLSKYQGKTYRLIMKAQNPDQME
KHIAADFDPRASYLESEKNYSPTDSGPGVGEGTGPGSRIGTGIGEEEEEDQEEEEVGVGL
ERDESLVAGSLPESQSKTNQEEFEASSEYSDRLPLGAEAVDIAQEINGNYRQTER
Download sequence
Identical sequences F6WTV5
XP_007478200.1.35504 XP_007478201.1.35504 XP_007478202.1.35504 XP_007478203.1.35504 XP_007478204.1.35504 ENSMODP00000012185 ENSMODP00000012185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]