SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012194 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012194
Domain Number 1 Region: 560-693,732-905
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.59e-78
Family Protein kinases, catalytic subunit 0.00000000306
Further Details:      
 
Domain Number 2 Region: 204-303
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000619
Family I set domains 0.071
Further Details:      
 
Domain Number 3 Region: 105-197
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000791
Family I set domains 0.032
Further Details:      
 
Domain Number 4 Region: 22-110
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000951
Family I set domains 0.016
Further Details:      
 
Domain Number 5 Region: 319-409
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000393
Family I set domains 0.031
Further Details:      
 
Domain Number 6 Region: 419-438,472-502
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000232
Family I set domains 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012194   Gene: ENSMODG00000009759   Transcript: ENSMODT00000012419
Sequence length 959
Comment pep:novel chromosome:BROADO5:1:342879191:342928355:-1 gene:ENSMODG00000009759 transcript:ENSMODT00000012419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPGILIPLMAVVVWHSQATPMIEPSGPNLVVERGSTITLRCEGNANVDWVSDVNLHTNG
WIQDTMGNLSTLSIINSTISHTGTYQCLEKGEENSNGDNSTASLHLYVKDPENLWSVPHS
EVTAEEDSDVLLPCRITDPTAEPWVSLEHSYGKPFRSHYTFDSRKGITIQKVQFIHRGDY
RCKTVVGGKSKYSSKISLIVDKVLLGPPKLWLEPSELVQIQGEPVQIICRATNPDVHFDL
VFKHQQKETSYLNKYDYNSNDDVYQNTINFTIPAVGPEDGGTYFCNASNPKGYNISFTVL
KVVEHGYVNLSSEQSLRLEMDVGKDLVLMVSVETYPTMLHWNWTYDGPFLNSQRSLPNSI
SETTYRFNTTLPLSRLKESEAGYYTFHAENSDAKASLSFEVILNYPPEVQVQQAEFNISN
VLRCIAFGYPAPEIMWYRCSGKEERCNQDRVLLWRDINASVVSQEPFHKVKVESMLHIQT
LMENTTYMCMASNKVGNNSHSFWPILTKPSFQPERDSLFTPILMVCISIMVVLSLLLLLL
LYKYKQKPKYQVRWKIIEACEGNNYIFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKV
VEATAFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHG
GPVLVITEYCHYGDLLNFLRRKAEDMLVPTLSAEPDGGPGYRNVHLEKKYMHGQGLDTYV
EMRPVSSSSSGSFSEQELDQEDGRPLELCDLLRFSSQVAQGMAFLASKNCIHRDVAARNV
LVTSRRVAKIGDFGLARDIMNDTNYVVKGNARLPVKWMAPESIFDCVYTVQSDVWSYGIL
LWEIFSLGLSPYPGILVNSKFYKLVKEGYQMAQPNFSPPNIYSIMQACWDLEPTRRPTFQ
QICSFLQEEMDATSKKQDYANLPSSGSSEEEDSVSEPLDCCDQVDSSQPLLQANNYQFC
Download sequence
Identical sequences F6WT52
ENSMODP00000012194 ENSMODP00000012194 XP_007473921.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]