SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012227 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012227
Domain Number 1 Region: 16-100
Classification Level Classification E-value
Superfamily Immunoglobulin 5.38e-29
Family V set domains (antibody variable domain-like) 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012227   Gene: ENSMODG00000023042   Transcript: ENSMODT00000012452
Sequence length 101
Comment pep:novel chromosome:BROADO5:1:715668584:715669141:-1 gene:ENSMODG00000023042 transcript:ENSMODT00000012452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CLLLLWVPGSRGAVGLTQSPSSLAVSPGEMVTLSCRATQSVGNNMTWYQHPPGQSPRPLI
YYASTLHSGVPARFSGSGSGTDFSLTISAVEPEDIRDSYCL
Download sequence
Identical sequences F6SZT0
13616.ENSMODP00000012227 ENSMODP00000012227 ENSMODP00000012227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]