SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012269 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012269
Domain Number 1 Region: 18-129
Classification Level Classification E-value
Superfamily Immunoglobulin 5.26e-34
Family V set domains (antibody variable domain-like) 0.0000595
Further Details:      
 
Domain Number 2 Region: 134-235
Classification Level Classification E-value
Superfamily Immunoglobulin 2.97e-26
Family C1 set domains (antibody constant domain-like) 0.0000435
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012269   Gene: ENSMODG00000009815   Transcript: ENSMODT00000012494
Sequence length 237
Comment pep:novel chromosome:BROADO5:1:715565441:715902454:1 gene:ENSMODG00000009815 transcript:ENSMODT00000012494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AQLFCLLLLWVPGSRGDIEVTQSPYSLAVSLGETVTLSCRASQSVSNQSISNWLHWFQHP
PGQAPRLLIYLASSLHSGVPARFSGSGSGTDFSLTISAVEPQDIGLYCCSLVKRNHCVYT
FGDGTQLEIKRSVATPSAFIFQPSPEQLQTGSASLVCLVNNFYPKEASVVWKVDNAVKNT
GISTSVTEQDSKDNTYSLSSTLALSANDYNNHETYSCEIIHQSLPSPLVKSFQRSQC
Download sequence
Identical sequences F6SFX9
ENSMODP00000012269 ENSMODP00000012269 13616.ENSMODP00000012269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]