SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012299 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012299
Domain Number 1 Region: 22-120
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000421
Family V set domains (antibody variable domain-like) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012299   Gene: ENSMODG00000009827   Transcript: ENSMODT00000012524
Sequence length 206
Comment pep:known chromosome:BROADO5:2:211162115:211172458:-1 gene:ENSMODG00000009827 transcript:ENSMODT00000012524 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLGSQTIEEAIPESRGNTCTKLWQYPRFMAKKRDSSFSVTCHVNGYGQVTWLRKQESDA
SPQVLKTNNGQIVESRNGSTLTLTIQKIQFEDNGIYYCQQVCMDNPNKIFQGCGTELRVM
GYSTVAQLKRRNTLKDAIIMIQTLLIIVFITVPVFLLLDKDDNKVVLEDDHTYEGLEIDQ
TATYEDIVTLRTGEVKWSVGEHPGQE
Download sequence
Identical sequences F6RX32
ENSMODP00000012299 ENSMODP00000012299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]