SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012346 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012346
Domain Number 1 Region: 33-122
Classification Level Classification E-value
Superfamily Immunoglobulin 1.67e-16
Family I set domains 0.021
Further Details:      
 
Domain Number 2 Region: 229-334
Classification Level Classification E-value
Superfamily Immunoglobulin 3.25e-16
Family I set domains 0.01
Further Details:      
 
Domain Number 3 Region: 165-237
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000435
Family I set domains 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012346   Gene: ENSMODG00000009865   Transcript: ENSMODT00000012571
Sequence length 398
Comment pep:novel chromosome:BROADO5:1:20593118:20668111:-1 gene:ENSMODG00000009865 transcript:ENSMODT00000012571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGSSLPSSLALSLLLVTGSLLPVPGAAQNAGFVKSPMSETKLTGDAFELYCDVVGSPTP
EIQWWYAEVNQPESFRQLWDGARKRRVTVNTAYGSNGVSVLRITGLTLEDSGTYECRASN
DPRRNDLRQNPSLTWIRAQATISVLQKPRIVTSDEVIIRDSPAPSFTLQCNLTSSSHSLQ
YSYWTKNGVELTTTRKNVSNMEYKVNKPRSEDSGEYHCVFQFLNAPKANATIEVKALPEI
TGHKRSENKNEGQDALMYCKSVGYPHPEWIWRKKENGIFMDLVNTSGRFFITNKENYTEL
YIINLQITEDPGEYECNATNTIGSDSFVTVLRVRSHLAPLWPFLGILAEIIILVVIILIY
EKRKRPDEVPDDDEPAGPMKTNSTNNHKDKNLRQRNTN
Download sequence
Identical sequences F6VV84
ENSMODP00000012346 XP_007478183.1.35504 ENSMODP00000012346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]