SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012360 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012360
Domain Number 1 Region: 722-1300
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 1.06e-201
Family Myeloperoxidase-like 0.000000000494
Further Details:      
 
Domain Number 2 Region: 42-238
Classification Level Classification E-value
Superfamily L domain-like 1.47e-43
Family Ngr ectodomain-like 0.0016
Further Details:      
 
Domain Number 3 Region: 329-425
Classification Level Classification E-value
Superfamily Immunoglobulin 5.63e-24
Family I set domains 0.0049
Further Details:      
 
Domain Number 4 Region: 413-506
Classification Level Classification E-value
Superfamily Immunoglobulin 1.02e-22
Family I set domains 0.012
Further Details:      
 
Domain Number 5 Region: 233-328
Classification Level Classification E-value
Superfamily Immunoglobulin 1.52e-22
Family I set domains 0.012
Further Details:      
 
Domain Number 6 Region: 505-596
Classification Level Classification E-value
Superfamily Immunoglobulin 1.1e-21
Family I set domains 0.011
Further Details:      
 
Domain Number 7 Region: 1396-1455
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000743
Family VWC domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012360   Gene: ENSMODG00000009863   Transcript: ENSMODT00000012585
Sequence length 1466
Comment pep:novel chromosome:BROADO5:3:189191999:189772886:1 gene:ENSMODG00000009863 transcript:ENSMODT00000012585 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPKRGCWTACFLLALWVLPALSCPSRCLCFKSTIRCMHLMLDHIPKVSQQTTVLDLRFN
RIQEIPTGSFKKLKNLNTLLLNNNQIRKISRNAFEGLENLLYLYLYKNEIHTIDAQAFKG
LISLEQLYIHFNQIETLQPETFGDLQKLERLFLHNNKLSKIPSGSFSNLDSLKRLRLDSN
ALICDCDLTWLGQLLKGYAQTGHTQAAATCEYPRSLQGRSIVSLGPDEFNCERPRITFEP
QDVDVTSGNTVYFTCRAEGNPKPKIIWLHNNHSLDMKDNARLNLLDDGTLMILNTRESDQ
GVYQCMAKNSAGEVKTQNAILRYTSLPTKPSFVIQPQDTEVLIGTSATLECMATGHPQPL
IVWTRGKSGPLDESRYIITSGGLFIQNITLQDHGQFTCHASNQHGSIQSTADIIVQAPPQ
FTVIPTDQTVLEGHTVEFPCEADGNPSPIIAWTKAGGQLPQEGQHLLLSSGTLRIVHVAE
HDEGQYECQAVSSLGVKRVIVQLTVHRRVLPVFTQLPQDSSVEVGKNINISCSAQGEPQP
TITWNKAGVQITESGKFHVNSEGTLTVKDVGQADQGRYECVARNHFGFAAASMLLTTIAI
QGRQAGDNFVESSILDAIQRVDSAINSTRRNLFSQRPRTPSDLLAQFRYPRDPFTVETAR
AGEIFEQTLQLIQENVKQGLTVDLEHQEFRYNDLVSPHYLSLIANLSGCTAHRRSPNCSD
ICFHQKYRTHDGTCNNLQNPMWGASMTAFERILKPVYENGFNLPRGVSPNSFANKYSLPL
PRTVSTKMVGTATITPDDRYTHMLMQWGQFLDHDLDQTVPALSMSRFSDGQSCSSVCTND
PPCFPILIPPNDARVANSHCMFFVRSSPVCGSGMTSLMMSSVYAREQINQLTSYIDASNV
YGSSDRESEELRDQTDQRGLLKKGVFAPSSGKYLLPFSTGPPTECSRDENESLIPCFLAG
DHRANEQVALTAMHTLWFREHNRIAMELSTLNPHWDGDTIYNEARKIVGAQMQHITYSHW
LPKILGDHGMKMLGNYKGYDPNVNSGIINSFATAAFRFGHTLINPILYRLNDTFGEIPEG
HLPLHKAFFSPFRIIQEGGIDPLLRGLFGVAGKLRVPSQLLNTELTEKLFSMAHSVALDL
AATNIQRGRDHGIPPYTDFRVFCNLTSVESFEDLHNEIKDPNIREKLKELYGTPFNIDFW
PALIVEDLIPGTRVGPTLMCLFVTQFQRLRDGDRFWYENPGVFTPAQVTQLKQASLAHIL
CENGDNIQQVQADVFLKAEYPQGYMNCNEIPKIDLRMWQDCCEDCGTRGQFRAFTQELRR
KRALQYSYSEEKNEDFDDVNNRYNKKLSVAKNTENRTHLSSSSFPQDFSHFAAEVQETII
SLRKQINKLEARLRQEGCMDDNRIHRRDNEHWMKEDCISCICKNGQVTCTMKTCPPAECL
HPQMAKGVCCPLCVGNEKTEDSPEEL
Download sequence
Identical sequences F6VTX1
ENSMODP00000012360 ENSMODP00000012360 XP_007487202.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]