SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012399 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012399
Domain Number 1 Region: 1395-1511
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.24e-36
Family Spermadhesin, CUB domain 0.00035
Further Details:      
 
Domain Number 2 Region: 935-1045
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.32e-36
Family Spermadhesin, CUB domain 0.00031
Further Details:      
 
Domain Number 3 Region: 593-704
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.06e-35
Family Spermadhesin, CUB domain 0.00082
Further Details:      
 
Domain Number 4 Region: 2232-2339
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.1e-34
Family Spermadhesin, CUB domain 0.00045
Further Details:      
 
Domain Number 5 Region: 3158-3284
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-33
Family Spermadhesin, CUB domain 0.00058
Further Details:      
 
Domain Number 6 Region: 2701-2805
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-33
Family Spermadhesin, CUB domain 0.00034
Further Details:      
 
Domain Number 7 Region: 1169-1281
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.19e-33
Family Spermadhesin, CUB domain 0.00039
Further Details:      
 
Domain Number 8 Region: 1061-1163
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-32
Family Spermadhesin, CUB domain 0.00041
Further Details:      
 
Domain Number 9 Region: 1630-1737
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-32
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 10 Region: 3041-3153
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.23e-32
Family Spermadhesin, CUB domain 0.00035
Further Details:      
 
Domain Number 11 Region: 711-818
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-31
Family Spermadhesin, CUB domain 0.00089
Further Details:      
 
Domain Number 12 Region: 1742-1852
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-31
Family Spermadhesin, CUB domain 0.00059
Further Details:      
 
Domain Number 13 Region: 3399-3511
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-31
Family Spermadhesin, CUB domain 0.00022
Further Details:      
 
Domain Number 14 Region: 1514-1620
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.36e-31
Family Spermadhesin, CUB domain 0.00095
Further Details:      
 
Domain Number 15 Region: 2456-2569
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.28e-31
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 16 Region: 1983-2093
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.8e-30
Family Spermadhesin, CUB domain 0.00034
Further Details:      
 
Domain Number 17 Region: 3515-3627
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-29
Family Spermadhesin, CUB domain 0.0008
Further Details:      
 
Domain Number 18 Region: 2340-2452
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-29
Family Spermadhesin, CUB domain 0.00059
Further Details:      
 
Domain Number 19 Region: 2096-2217
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.13e-28
Family Spermadhesin, CUB domain 0.0007
Further Details:      
 
Domain Number 20 Region: 2925-3038
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-28
Family Spermadhesin, CUB domain 0.00033
Further Details:      
 
Domain Number 21 Region: 828-932
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-28
Family Spermadhesin, CUB domain 0.00076
Further Details:      
 
Domain Number 22 Region: 1861-1967
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-28
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 23 Region: 1283-1391
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.66e-28
Family Spermadhesin, CUB domain 0.00074
Further Details:      
 
Domain Number 24 Region: 470-589
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-27
Family Spermadhesin, CUB domain 0.0019
Further Details:      
 
Domain Number 25 Region: 2575-2691
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.63e-24
Family Spermadhesin, CUB domain 0.00056
Further Details:      
 
Domain Number 26 Region: 2809-2922
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-19
Family Spermadhesin, CUB domain 0.00091
Further Details:      
 
Domain Number 27 Region: 3282-3397
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.14e-18
Family Spermadhesin, CUB domain 0.0035
Further Details:      
 
Domain Number 28 Region: 134-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000131
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 29 Region: 434-471
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000111
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 30 Region: 395-436
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000292
Family EGF-type module 0.014
Further Details:      
 
Domain Number 31 Region: 132-267
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000251
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 32 Region: 305-364
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000248
Family EGF-type module 0.013
Further Details:      
 
Domain Number 33 Region: 355-395
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000653
Family EGF-type module 0.073
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000012399
Domain Number - Region: 265-319
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00193
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012399   Gene: ENSMODG00000009905   Transcript: ENSMODT00000012625
Sequence length 3628
Comment pep:novel chromosome:BROADO5:8:256860317:257160037:1 gene:ENSMODG00000009905 transcript:ENSMODT00000012625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWPAPFLCLLVFLLILTGLDGESEQHELYRQKRNTNYQQQPRMTSERGNLVFVTGSAQN
IEFRTGTQGKIKMNEEDLGECLNQIQKNKDDITELKRNSVGLPQNVSYEITHLNHQLMDL
ERRFQSLQQTVQRKVCSSNPCQNGGTCLNLLDSFFCLCPPNWMGPVCSADVNECMIYAGT
PLSCHNGATCLNTAGSYSCTCKPDNYGPQCASVYNDCHGGSKELCVHGICENLEREQPGK
PKYRCICDAGWAPTPNNSSCTVDVDECSLPNPPCSQNPLVECFNTPGSFYCGPCPVGWKG
SGYSCEDINECETDNGGCSVAPMVKCINTAGSYECGSCPPGYQGNGKVCTPMDICLENNG
GCHPHALCTPGSGSIPTCVCQAGYTGHGYGQNGCVPLSHICRSDPCVNGQCIETVSGYHC
ICDPGWEGINCTENTNECLSNPCFNGGTCTDDINGYSCECTSAWTGPQCQTPQQVCGGSL
SGLSGSFSYPNTQVMGYNDNINCFWVIRTEEGKVLHVTFPLFQLDSVDMCHSQFLQIHDG
DSSGAYLLGKYCGSSHPPELLLSSNNALYFYFHSDQSVNNRVFTVRWETQQPECGGLLTN
TYGSIISPGYPGNYPPSRDCVWIIRTNPGLVLTFAFGTLSLEHHANCSGDYLEVRDGPLN
HDPVLGKFCSTLSEPPLHTTGPFAWIHFHSDSTGSDRGFHITYITSLVDPDCGGNFTDAE
GTLVSPDWPAPYIHNRQCIYIITQPPGEKIQLNFTQVELEGQNHCLQSSIEVRDGEILLE
KLCDSRTHASIYSISNSVWVRFKSDSAVQKASFKAIYQVACGGELTGEGIIRTPFYPNAY
PHEKTCDWKISQPQGQVILLNFTGLQIGNSSSCETDYVEILNSLSMDSPHNRKYCGTNNP
GLITSTYSTVYVRFKKSISSTNYGFLAHFSAADLECGEVLTAPSGNITSPGHPGIYPHGV
NCTWLISVQPGYRIRLVFRAFHLDFHYSCTTDYLEVYDDGTGISLGRYCGKSVPPSLMSS
GNRLVLHLVTDSSIAYEGFSVVYDSIEASKACLEDHTTQYGMIQSPNFPGNYPNNIDCIY
RIMVETGHQIALHFTNFSLDAAVGTSCIEDYVEIKDGGHEESPSLGIFCGINKPPMIISH
SNKLWIKFKTDTFGSSSGFSAFWDASLTGCGGNLTAPSGVFMSPNYPMPYFHSSECFWLL
KSSRGSQFEVTFEDFHLENDSNCRLDFLAVYDGLTADANLLAKLCGNEIPPLIRSSGDSL
LLKLQTDEQQQGGGFLAKYQQTCQDVVIANLSYGILESINYPNPYFGNQRCNWTIQVTAG
NTINYTFSAFELEDHRNCSVEYLELHDGPQPIARYCGAEIPPAGTTTGSKLHVLFHTDGV
GNNERGFQMYWNLNGCGGELNGPTGSFSSPGYPGNYPPNKECIWYIRTAPGSSIQLTIDD
FDVEYHLNCRYDVLEVYGGPDFHSPRVAQLCSSRSRDNPLRVSSTGNSVAIRFKTDNSIN
GRGFNASWQEIPGGCGGIFQASSGEIHSPNYPNSYRSNTDCTWVIRVDRNYHVLLNFTDV
DFEPQDACITVHDGSNAASARIVNVCGRQQPAPVISSRNTLFVRFQSTSANQNRGFRARF
IEACGSFIVTDSIGSISSPLFPAKYQSNQNCSWIIQAQPPFNHITLSFTHFELESSTNCS
RDFIEILDGSDYDAPLQGRYCGRTMPLPITSFSNSLILKFISNANANFEGFHATYAASSS
ACGGTFHMAEGIINSPGYPDIYPPNMECIWNIPSSPGNQLQLSFITFQLEENEDCTKDYL
EIREGNATGHLVGRYCGHSSSFNYTSIIGQNLWIKFVSDGSGSDIGFQATFVHTFGNDNI
VGSHGKIASPLWPRNYPHHSDYRWTVNVNDSQIIHGTILEMDLEKSYGCYFDKLMIYDGP
NIHSRLIGTYCGTQTTSFTSIRNSITFRFFSDSSISRKGFLLEWYAVESHLRPAAPTIAT
GACGGYLRSGEAPGFFYSPRWPENYNNGADCSWVIHAPDSTVELNILSLDIESQQSCTYD
RLVIRDGDSNADQQLTVLCGREVPGPIRSSGEYLFIRFTSDFSVTGAGFNASFHKSCGGY
LHTGRGVITSPNYPETYPPNLNCSWHVLVPSGLTIAVHFEQPFEIPNGEPSCNHGDYLVM
KNGPDNSSPALGPREGNGRFCGNTPFSTLYTTDNQMFVHFVSDNSDGGQGFKIKYEAQSL
ACGGNIYLHDSNTDGYVTSPNYPDNYPAHADCIWTISVPSGRLVKLQFEDHFNIEISTNC
TSNYLELRNGGDSDAPILSRFCGTSLPSSVLSSGDAIYLRFRTDDSPTHIGFKAKYSIAS
CGGMVMGQNGVIESPQYFEHPYPDYLLCEWFLQGPSGHYLTLHFDVLNLQNSFHCEKDFV
EIREGDESGNVLGRYCGNTIPLAIDTSNNFAFVKFVTNESISAPGFRLVFEASPDECGGD
IYGHTGIFTSPRYPNANSHSRVCEWRITVPEGRRVTLTFNDLRLGNHQLCDNEYVTVFNG
IRSNSPQLEKLCSHVFTRNSIESSGNTMRVLFVTDGSRPYGGFSASYTSSEDAVCGGLLT
APIGGIFTSPGYDGVTNYTKNLNCEWTISNPNEHNSSIYISFEEFHLEDHQACHFDALEF
RIGNADGPLIRKICGQSVPTVPFAIPFSQIWAHFVTNELVENKGFSAHYSFTDCGGIRIG
EGGVITSPNYPATYGSLNHCSWLLEAPQGHTITLSFTFFDIESHSQCKWDSVTVLNGGSP
GSPVVGHYCGARIPRPIQSGSNQLMVIFNSDRSVQQGGFYATWTTQTLGCGGILHFDNGT
IKSPYWPQHFPENSRCTWAVITHESRHLEISFDNNFLIPSSDGQCQDSYIKVWAGARETE
AALLATACGNVPPSSLIVPRNIFTAVFQSQGAPGQGFSASFISRCGANFTSPSGYIVSPN
YPSQYDNNMNCNYIIKAEPQEMVILNFQSFHLEVPSELSGGCINDGIKIIRGYQASSTPT
ATFCGNEIPESISVSGPMTLHFYTNSHNTDFGFKATYRKIPCGGRFNSSFNIIRSPGYPQ
SNYPNNMDCSYLITVRNDKVIELKFSDFTVALSTFCSQDYFAVYDGPNTSAPLLGKFCGS
QLPPNIKSTDNSLLLVFKTDVFETAKGWKLSFRETLGPQHGCGGYLTNSSFTFASPDSNA
DGKYDKNLNCVWVIAAPVNKVINLTFTTFFLEGQSSFRGCIYDYVKVYDGDSENADLVGT
FCGSTLPAPFISRGNFLTIKFVSDYFVEMEGFNVTYATLDLPCGGTFNATLTPQTATSPH
SPDPLFPLSVCTWVIDAPPQQQVKLVIEAFQLHSEDCSQNYLQIQDSPENDQNPVHKFCR
NDASAVPEFYSSHRTAIVVFKTQEFQSDSKVRFTYQVADCNREYNQAFGYLKSPGWPENY
PHDLDCSIILRAPQNHSITLFFHSFSVDSTSECRDDFLEIRNGNDRSSPLLGKYCGSQLP
NPIFSKNHLLYLRFKSDAIHSSHGYEILWTSSPFGCGGPLYGDAGSVTSPGYPGTYGNNT
HCEWTLTAPAGRTLTVTFYFVSIDDPGNCIQNYLIVYDGPDASSPSSGPYCGADTEIAPF
VASSNRVFIIFHADYAVSPSAFRLTWSS
Download sequence
Identical sequences F6UUU8
XP_001377380.1.35504 ENSMODP00000012399 ENSMODP00000012399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]