SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012411 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012411
Domain Number 1 Region: 129-214
Classification Level Classification E-value
Superfamily Immunoglobulin 5.49e-19
Family I set domains 0.04
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000012411
Domain Number - Region: 44-120
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00294
Family I set domains 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012411   Gene: ENSMODG00000009919   Transcript: ENSMODT00000012637
Sequence length 261
Comment pep:novel chromosome:BROADO5:2:515069894:515091592:-1 gene:ENSMODG00000009919 transcript:ENSMODT00000012637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWKKNRLIQSFGSLLLVILLLPCALMNVILTVNNNPENFVLPATVNSSKSLLCAVQNHS
QGEELLWFREDGRVDLRAENKINSSAICVSVREDDNGVTFTCKLQRDQSMSISVILNVTY
SPTLSGKDVQTVEEGSNVKLDCNVKSNPSAEMTWYRNNDVLNLEKNHHQIYQTSELFQLS
ISKVQKSDNGTYNCQAKFLEKTITKDFHLIVEDKKFTVPIEPIIAASVVVFFTIMFGLFA
RRQKLMKLCIKDQSPQSETPL
Download sequence
Identical sequences F6R9D3
XP_007485788.1.35504 XP_007485789.1.35504 ENSMODP00000012411 ENSMODP00000012411 13616.ENSMODP00000012411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]