SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012421 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012421
Domain Number 1 Region: 379-574
Classification Level Classification E-value
Superfamily Fibronectin type III 3.92e-48
Family Fibronectin type III 0.00000316
Further Details:      
 
Domain Number 2 Region: 572-773
Classification Level Classification E-value
Superfamily Fibronectin type III 1.31e-35
Family Fibronectin type III 0.00000286
Further Details:      
 
Domain Number 3 Region: 780-977
Classification Level Classification E-value
Superfamily Fibronectin type III 3.48e-34
Family Fibronectin type III 0.00000141
Further Details:      
 
Domain Number 4 Region: 275-370
Classification Level Classification E-value
Superfamily Immunoglobulin 1.73e-21
Family I set domains 0.0092
Further Details:      
 
Domain Number 5 Region: 191-284
Classification Level Classification E-value
Superfamily Immunoglobulin 2.23e-21
Family I set domains 0.007
Further Details:      
 
Domain Number 6 Region: 82-177
Classification Level Classification E-value
Superfamily Immunoglobulin 4.64e-17
Family I set domains 0.053
Further Details:      
 
Domain Number 7 Region: 5-99
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000045
Family I set domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012421   Gene: ENSMODG00000009924   Transcript: ENSMODT00000012647
Sequence length 1385
Comment pep:novel chromosome:BROADO5:1:19999028:20184964:1 gene:ENSMODG00000009924 transcript:ENSMODT00000012647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTLSVRGSSVILNCSAYSEPSPKIEWKKDGTFLNLVSDDRRQLLSDGSLLINSVVHSKH
NKPDEGYYQCVATVESLGTIVSRTAKLTVAGLPRFASQPESSSVFVGNSAVLNCEVNADL
IQFVRWEKDRQPLVLDDRVIKLPNGALVISNVTERDGGLYRCIIESGGPPKYSEEAELKV
LPGMKFPSNLVFLSQPSPLTRVIGQSAVLPCIASGVPIPVIRWTRNEEALSPESSERLML
LAGSNLEISDLTEEDAGTYACVADNGNETIEAQAELTVQVSPEFLKQPANIYAHESMDIV
FECEVTGKPMPTVKWVKNGDMVIPSDYFKIIKEHNLQVLGLVKSDEGFYQCIAENDVGNS
QAGAQLIILDHAPATTGPLPSAPRDVVASLVSTRFIKLTWRTPASDPHGDNLTYSVFYTK
EGINRERIENTSHPGEMQVTIQNLMPETVYVFRVVAQNRHGSGERSLPLRVETQPEVQLP
GPAPNIRAYASSPTSITVTWETPLSGNGEIQNYKLYYMEKGADNEQDVDVGSRSYTINGL
KKYTEYSFRVVAYNKHGPGVSTQDVVVRTLSDVPSAAPQNLSLEVRNSKSIVIHWQPPPA
GSQNGQITGYKIRYRKSSRKSDVTESVGGTQLFQIIEGLDRGTEYNFRVAALTVNGTGPA
TDWMSAETFESDLDETRVPEVPSSLHVRPLITSIVVSWTPPENQNIVVRGYAIGYGLGSP
HAQTIKVDYKQRYYTIENLDPSSHYVITLKAFNNVGEGIPLYESAVTRPHSVPDPTPMMP
PVGVQASILSHDTIRITWADNSLPKHQKITDSRYYTVRWKTNIPANTKYKTANATTLSYL
VTGLKPNTLYEFSVMVTKGRRSSTWSMTAHGTTFELVPTSPPKDVTVVSKEGKPRTIIVN
WQPPSEANGKVTGYIIYYSTDVNAEIHDWVIEPVVGNRLTHQIQELTLDTPYYFKIQARN
SKGMGPMSEAVQFRTPKADSSDKMPNDQASGSSGKGSRPPDTGSDYKPPMSGSNSPHGSP
TSPLDSNMLLVIIVSIGVITIVVVVIIAVFCTRRTTSHQKKKRAACKSVNGSHKYKGNSK
DVKPPDLWIHHERLELKPIDKSPDPNPIMTDTPIPRNSQDITPVDNSMDSNIHQRRNSYR
GHESEDSMSTLAGRRGMRPKMMMPFDSQPPQPVISAHPIHSLDNPHHHFHSSSLASPTRN
HLHLQGSPWPIGTSLSHSDRANSTESVRNTPSTDTLPASSSQTCCTDHPDPEGAPSSSYL
ASAQEEGSGPNLPTAHVRPSHPLKSFAVPAVPPPGPPTYDPALPSTPLLSQQATNHHLHS
VKTASIGTLGRSRPPMPVIVPSAPDVQETTRMLDDSESSYEPDELTKEMAHLEGLMKDLN
AITTA
Download sequence
Identical sequences F6R923
ENSMODP00000012421 13616.ENSMODP00000012421 ENSMODP00000012421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]