SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012441 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012441
Domain Number 1 Region: 160-243
Classification Level Classification E-value
Superfamily Immunoglobulin 2.1e-18
Family I set domains 0.0016
Further Details:      
 
Domain Number 2 Region: 257-323
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000174
Family I set domains 0.016
Further Details:      
 
Domain Number 3 Region: 47-138
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000519
Family V set domains (antibody variable domain-like) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012441   Gene: ENSMODG00000009963   Transcript: ENSMODT00000012667
Sequence length 412
Comment pep:novel chromosome:BROADO5:4:369836397:369849575:-1 gene:ENSMODG00000009963 transcript:ENSMODT00000012667 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQWAAQSGGASLNASPRWGQPLKRLLITVSILSFWIKPISAKGASVSVVPSPPYGRMGSN
VTLTIHGFSEQALSYNWYRKTTEDSNKIISYSVPSRMQIPADIREKVYPNGFLLIPNLTL
SDTELYIVQIVDSRGVIAVIAQGQLRVYDEVAKPNIAVNSTNNRENDSVFFTCSTENKEE
NILWFSNNQPLSLNERMSLSRNNQTLTILRVKREDTGSYQCQASNPISSNRSDPLTLTVI
YGPSHIEIFPRPESGEIKLRFNDPLTLECQALSYPAAQYEWHVNDTLGSVYSGSSYIITS
ASWEHSGKYTCWTRNKVTNLSISEDIIINVIGESPGGAIIGIVSGVLAGLVFTATLIYVL
FFRKTSQSCSDGSPNGTEEVSYASINFSTQKSCLVTQSPMSRDTIYSEIKKR
Download sequence
Identical sequences F6R843
ENSMODP00000012441 XP_007491603.1.35504 ENSMODP00000012441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]