SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012454 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012454
Domain Number 1 Region: 151-236
Classification Level Classification E-value
Superfamily Immunoglobulin 7.01e-17
Family I set domains 0.0011
Further Details:      
 
Domain Number 2 Region: 40-139
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000589
Family V set domains (antibody variable domain-like) 0.012
Further Details:      
 
Domain Number 3 Region: 248-320
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000101
Family I set domains 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012454   Gene: ENSMODG00000009946   Transcript: ENSMODT00000012680
Sequence length 432
Comment pep:novel chromosome:BROADO5:4:369943685:369971090:1 gene:ENSMODG00000009946 transcript:ENSMODT00000012680 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERPSGASQHGGSSWKEILITASFFSCWIQPQSAQGTLVSVVPRPPYGTVGSNVTLMIQG
YSGSIFSYNWFKNTTEVSNRIITYTVPVKEQMPADNRERGFPNGSLLIPNLTLNDTEVYI
VQIVNSEGMIATDAKVQFRVYEELVNPNITVNSTNIIENDSLVLTCSSENKGGNILWFFN
NQPLTLNERMNISENNETLTIMNVKWKDTGSYQCEVWNPISSKKSDNLTLILNYGPDHIT
ILQSPENGEIEVPFNDSLTLECQALSYPPAQYEFHINDTSGPIYSGSTYTIMYVSWEHSG
KYTCWARNNMTNLSISKDVTVKVANQSPEGGNGSLLSRGDITGIVIGGLAGVALTAVLIC
FLFFRKMRRVREHHLTKHRSSAPNRSQVCFDSSINETEEVSYASLNFSDQKLLALSQAPT
STDIVYSKIKVK
Download sequence
Identical sequences F6QMW6
ENSMODP00000012454 ENSMODP00000012454 XP_007491609.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]