SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012481 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012481
Domain Number 1 Region: 170-255
Classification Level Classification E-value
Superfamily Immunoglobulin 3.99e-19
Family I set domains 0.0018
Further Details:      
 
Domain Number 2 Region: 261-333
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000111
Family I set domains 0.029
Further Details:      
 
Domain Number 3 Region: 57-144
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000212
Family V set domains (antibody variable domain-like) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012481   Gene: ENSMODG00000009913   Transcript: ENSMODT00000012707
Sequence length 348
Comment pep:novel chromosome:BROADO5:4:370005149:370162072:1 gene:ENSMODG00000009913 transcript:ENSMODT00000012707 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELPGKEKAVICRGKHRLIESPSKAPHIMGSSWKVLLIAASILSCWIQSTSAQGNPVRIV
PIPPYGTVGSNVLLTILGFTEKGSTYTWYRKTREASNQIASYSLRTRVQTPEDSREKILP
DGALLIPNLSLSDASIYILKITIYSVGVGVYEVITQLRVYEKLARPNITANSIKVRENES
LVFTCSTENERANIVWFFNNQPLPLTERTDTSENNQTLTIKSVRREDAGIYQCEAWNPID
ARRSNPFSLMVNYGPDTIKIFQSPESEKIEVQFNNSLTLECQAPSNPPVHYEWHAHDSSE
LIHSGSTYTIPHASWEHSGKYTCWARNNVTNGTNDYTIKKQVLTMLSP
Download sequence
Identical sequences F6Y7Z8
ENSMODP00000012481 ENSMODP00000012481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]