SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012491 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012491
Domain Number 1 Region: 223-325
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000456
Family I set domains 0.055
Further Details:      
 
Domain Number 2 Region: 365-472
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000385
Family V set domains (antibody variable domain-like) 0.029
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000012491
Domain Number - Region: 21-89
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00108
Family V set domains (antibody variable domain-like) 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012491   Gene: ENSMODG00000009976   Transcript: ENSMODT00000012719
Sequence length 529
Comment pep:novel chromosome:BROADO5:2:165756069:165760815:1 gene:ENSMODG00000009976 transcript:ENSMODT00000012719 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGLLSLMSPMFPAGVCGAREVVVPEGPLYRVAGTAISISCNVSHYEGPSQQDFEWFLYRP
EAPEAALGIISTRDARFPYAIFGPRVASGDIQVSSLSFFILMLHPYVCIDKRCWFLETHC
RGGGGVRQVGTDAPSACGWEPESRVARPEARGLGMRAGVLFCPLFPRHRLEAPGGRMGMK
SVLGISFGRRNWSHDREGEESPTLTSWSLFSVPLSVSASQLAVVVGPGERRVGPGEPFEL
LCNVSGALPPPGPHAAYSVGWEMAPAGAPGPGHLVAQLDTEGIGSLGPGYEERHISMEKV
APITYRLRLEAARPGDAGTYRCLARAYVRGPGARLREAASVRSRPLPVHVREEGVVLEAM
AWLAGGVVYRGETASLFCNISVRGGPPGLRLANSWWVEWSGDSGLVQPAPQLVGGMAWDG
VAELGVRPGGGAVSVEQVGPRSHRLRLHDLGPQDEGVYHCAPSAWVQHADYSWYQAGSAR
SEAITVYPYTRPLDTLFVPLLVGTGVALVTGITILSTVTCCFMKRLRKR
Download sequence
Identical sequences F6Y7E3
ENSMODP00000012491 13616.ENSMODP00000012491 ENSMODP00000012491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]