SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012539 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012539
Domain Number 1 Region: 34-137
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000935
Family V set domains (antibody variable domain-like) 0.083
Further Details:      
 
Domain Number 2 Region: 138-219
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000328
Family I set domains 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012539   Gene: ENSMODG00000010009   Transcript: ENSMODT00000012767
Sequence length 294
Comment pep:novel chromosome:BROADO5:2:165939502:165945970:1 gene:ENSMODG00000010009 transcript:ENSMODT00000012767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWMKVPPWLFFLVLLGPQEGKGQSGEQEELDSKELMLVLGESVSLPVNIEEGEEIEKII
WSFHSTLAVIQQEAMKEPSISIVPDPRYNVIVNISDHTYSLHISNLSKEDEGTYRAEMNF
EGFPGTITQKFILRVYRRLPKPKVTVILEISEESVCNVTLKCHVDGKGDEEEFSWTSLDP
GAIVSDGGSVLHLSWRPGDSDWTSTCIVRNPVSFSSHSLPVEQFCTGPKVSSSTSCSSLV
KGLFILLLFGFLIVGIIVTRHLIKNKESATRRIHRGLKLRKGVKRENLQVKEFP
Download sequence
Identical sequences F6UAS7
ENSMODP00000012539 XP_007481722.1.35504 XP_016285765.1.35504 ENSMODP00000012539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]