SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012555 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012555
Domain Number 1 Region: 149-241
Classification Level Classification E-value
Superfamily Immunoglobulin 9.97e-24
Family I set domains 0.021
Further Details:      
 
Domain Number 2 Region: 528-725
Classification Level Classification E-value
Superfamily Fibronectin type III 1.17e-23
Family Fibronectin type III 0.0024
Further Details:      
 
Domain Number 3 Region: 234-332
Classification Level Classification E-value
Superfamily Immunoglobulin 8.86e-20
Family I set domains 0.055
Further Details:      
 
Domain Number 4 Region: 35-150
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000471
Family V set domains (antibody variable domain-like) 0.081
Further Details:      
 
Domain Number 5 Region: 320-420
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000666
Family I set domains 0.028
Further Details:      
 
Domain Number 6 Region: 424-513
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000017
Family I set domains 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012555   Gene: ENSMODG00000010024   Transcript: ENSMODT00000012783
Sequence length 1183
Comment pep:novel chromosome:BROADO5:2:165972092:165996800:1 gene:ENSMODG00000010024 transcript:ENSMODT00000012783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGGAGCDSCAMIWCLAILSLLTSQGADGRVKPETVTVVGRTGESALLSCDLLPPTGRPPL
HVIEWLRFGFLLPIFIQFGLYSPRVDPHYVGRVRLQEGASLIIERLQTEDQGWYECRVLF
LDQPNPEDDFANGSWVHLTVNSPPRFLEIPPTELEVREWDPVTLHCAASGSPQPHVAWKR
DGRDLGQGQGQVQVQNGTLRIGRVEQSSAGIYTCHASNTEGSATHTTHLLVHGPPVIIVP
PENSTVNASQDASLACQAQAHPANLTYSWYQGSTNVFHISRLQPRVRILVDGSLRLQATQ
PDDAGRYTCVPSNGLRHPPSASAYLTVLYPAQVTAMPPETPLPVGMQGVIRCPTRANPPL
LFVNWTKDGQALHLDKFPGWSQASDGSLVIALGNEDALGEYTCTPYNSHGTAGPSSPTRV
LLKAPPAFIEQPKKEYFQEVGRELLIPCSAGGDPPPAITWAKVDRGLRGEAQVDSNSSLV
LRPLSKEAHGRWECRASNVVARVATTTNIYVLGTSPHAVTNVSVLALPEGANVSWEPGFD
GGYLQRFSVWYTPLAKRPDRAHHDWISLPVPAGAAHLVVAGLQPHTSYQFSVLAQNKLGS
GPFSEIILSSPDAGFLTTEEVPRLHPTESQLPLSPPRGLVATKTPRGVLLHWEPPLLAPE
TLASYALEGRHGSHGWEVLDRAISGADTQLLVPGLIKDSFYEFRLVAFAGSYISDPSNVA
NISTAGMEVYPSRTQLPGLLPQPVLAGVVGGVCFLSVAILISTIAACAMNRRRAARLRKR
HQDLPLIFSPQGSHLRSNSAPGSGSPDSMVKLKLQESPSLSLRQSLLWGEPAQLPSPPAA
QLLPNPLPLEPICRGPDGRFVMGPGAESPQVLLTQIQDEPQSEDHRQARSFDCSSSSPSG
VTQPLYIADISPVGPPPSPLPAPGPLLQYLSLPFFREMNVDGDWPPAEEPSPALPLDYMD
TRPGTETTQSRPLDSSLGLPKAVLPGGGVSGGGSDSSYTALADWTLRERGLPGPAPAVPR
GSLTSQSSGRGSASFFRPPSLAPSLGGSYLSPPSGDTSSWASGGIGLERWPRREHVLTVS
KRRNTSVDENYEWDSELPGDLELLESLHLGQRGSGLRVQPELKLGSKEPKEGTWDTAHLP
GPEERCAALREEFLAFRRRRDATRARLPVRRDPISHPEQATLL
Download sequence
Identical sequences F6U9U7
ENSMODP00000012555 13616.ENSMODP00000012555 ENSMODP00000012555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]