SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012559 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012559
Domain Number 1 Region: 160-241
Classification Level Classification E-value
Superfamily Immunoglobulin 2.41e-17
Family I set domains 0.001
Further Details:      
 
Domain Number 2 Region: 47-149
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000327
Family V set domains (antibody variable domain-like) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012559   Gene: ENSMODG00000010023   Transcript: ENSMODT00000012787
Sequence length 287
Comment pep:novel chromosome:BROADO5:4:370090308:370239827:-1 gene:ENSMODG00000010023 transcript:ENSMODT00000012787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPHNGQHRLWEKFSEAPYSGGNPWKWLLITASILSCWSQPTSAQDLTVVPEPANVKEGD
NVTLVLQGVSGTTLSYAWFSRSPGDSSDTEMVMYSVIYSMQTPANIRQKVLPNGSLLIPN
LVLNDTKYYTVQMVDTFGKILRGGAPLTVYEKLAKPMIAVNDTNILEDESLILTCSTENV
GANIRWFFNDQPLSLHGRMSTFENNQILLIKGVKREDSGSYQCEAWNPAHAKRSDALTLT
VSCESNGATLSGGAIMGVVIGVLAGVALLGALIYVLITKNTGRGGSF
Download sequence
Identical sequences F6U9R9
ENSMODP00000012559 ENSMODP00000012559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]