SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012581 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012581
Domain Number 1 Region: 147-255
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000113
Family I set domains 0.021
Further Details:      
 
Domain Number 2 Region: 31-129
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000142
Family V set domains (antibody variable domain-like) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012581   Gene: ENSMODG00000010046   Transcript: ENSMODT00000012809
Sequence length 419
Comment pep:novel chromosome:BROADO5:2:166113603:166173862:1 gene:ENSMODG00000010046 transcript:ENSMODT00000012809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGRGVFHLLLMCLSPALLSAVRINGDGQEVLYLAEGDNVRLGCPYILDPEDYGPSGLDI
EWMQVNSDPAHRENVFLSYQDKRINQGSLPHLQQRVRFASPDPSQYDASINLMNLQVSDT
ATYECRVKKTTMATRRVIVTVQARPAVPMCWTEGHMTYGNDVMLKCFANGGTPPLSYKWA
KISGRTHPYRASSYLSQHNYHSELSYQESFHSSVTHGLSNGDLLLKDISGEDDGLYQCTV
ANHVGYSVCVVEVKVSDSRRIGMIIGAVLGSLLLLACLLLGIWGLVCCCCGGAGVSRGAF
GYGNGGGVGGGACDMASEIREDALAPGCKGTRRGGSVTHLLGYPTQNISRSLRRKYAAPC
EGPEDVPLASCGVTVVPANATSVSAPCEAGPSPIYVKVKSAESGDCGEGQVKAKDGYLV
Download sequence
Identical sequences F6TTB1
XP_001369821.1.35504 ENSMODP00000012581 ENSMODP00000012581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]