SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012589 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012589
Domain Number 1 Region: 23-120
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000323
Family V set domains (antibody variable domain-like) 0.044
Further Details:      
 
Domain Number 2 Region: 145-209
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000161
Family I set domains 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012589   Gene: ENSMODG00000010050   Transcript: ENSMODT00000012817
Sequence length 279
Comment pep:novel chromosome:BROADO5:2:166167748:166186027:-1 gene:ENSMODG00000010050 transcript:ENSMODT00000012817 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMWTLQSLLLWEVLLPAVWAQVQGRVGGSVLLEAEVPPDFQVRDAIWRSLWPSEKLVAT
FFHGAPEILYDSRFLGRTLLHSNLSLEIQPLEPGDSGNFSVLLADVRGQTKSQTLQLTVY
EAVSRPTVQVFIAVSDGIQPPRTCQVFLSCVVPNSSEVTYSWQRKGAAELGNPQQGLFTD
NQVLRITLGPGDEDAVYSCIVSNPVSWDAVAVTPWESCLQNTEPGKKSYKDILLVAVPIS
LLLLLAGILSIWHCALCSGKKRRNSTSNSVTTETETPSV
Download sequence
Identical sequences F6TT75
XP_007481725.1.35504 ENSMODP00000012589 ENSMODP00000012589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]