SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012695 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012695
Domain Number 1 Region: 5536-5729
Classification Level Classification E-value
Superfamily Fibronectin type III 8.64e-47
Family Fibronectin type III 0.00066
Further Details:      
 
Domain Number 2 Region: 6820-7017
Classification Level Classification E-value
Superfamily Fibronectin type III 2.51e-45
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 3 Region: 8011-8205
Classification Level Classification E-value
Superfamily Fibronectin type III 4.09e-45
Family Fibronectin type III 0.00048
Further Details:      
 
Domain Number 4 Region: 4741-4942
Classification Level Classification E-value
Superfamily Fibronectin type III 4.82e-45
Family Fibronectin type III 0.00059
Further Details:      
 
Domain Number 5 Region: 2307-2503
Classification Level Classification E-value
Superfamily Fibronectin type III 1.02e-44
Family Fibronectin type III 0.00073
Further Details:      
 
Domain Number 6 Region: 12242-12438
Classification Level Classification E-value
Superfamily Fibronectin type III 1.73e-44
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 7 Region: 12639-12826
Classification Level Classification E-value
Superfamily Fibronectin type III 1.78e-44
Family Fibronectin type III 0.00048
Further Details:      
 
Domain Number 8 Region: 9392-9584
Classification Level Classification E-value
Superfamily Fibronectin type III 2.57e-44
Family Fibronectin type III 0.00079
Further Details:      
 
Domain Number 9 Region: 7222-7411
Classification Level Classification E-value
Superfamily Fibronectin type III 4.09e-44
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 10 Region: 3004-3196
Classification Level Classification E-value
Superfamily Fibronectin type III 4.1e-44
Family Fibronectin type III 0.00095
Further Details:      
 
Domain Number 11 Region: 4435-4635
Classification Level Classification E-value
Superfamily Fibronectin type III 4.87e-44
Family Fibronectin type III 0.00098
Further Details:      
 
Domain Number 12 Region: 9095-9284
Classification Level Classification E-value
Superfamily Fibronectin type III 8.55e-44
Family Fibronectin type III 0.00021
Further Details:      
 
Domain Number 13 Region: 3325-3523
Classification Level Classification E-value
Superfamily Fibronectin type III 1.11e-43
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 14 Region: 13424-13619
Classification Level Classification E-value
Superfamily Fibronectin type III 1.48e-43
Family Fibronectin type III 0.00034
Further Details:      
 
Domain Number 15 Region: 10763-10961
Classification Level Classification E-value
Superfamily Fibronectin type III 2.19e-43
Family Fibronectin type III 0.00059
Further Details:      
 
Domain Number 16 Region: 2507-2696
Classification Level Classification E-value
Superfamily Fibronectin type III 2.48e-43
Family Fibronectin type III 0.00034
Further Details:      
 
Domain Number 17 Region: 9681-9879
Classification Level Classification E-value
Superfamily Fibronectin type III 6.71e-43
Family Fibronectin type III 0.00069
Further Details:      
 
Domain Number 18 Region: 10077-10273
Classification Level Classification E-value
Superfamily Fibronectin type III 1.18e-42
Family Fibronectin type III 0.00093
Further Details:      
 
Domain Number 19 Region: 10474-10665
Classification Level Classification E-value
Superfamily Fibronectin type III 1.26e-42
Family Fibronectin type III 0.00061
Further Details:      
 
Domain Number 20 Region: 11556-11738
Classification Level Classification E-value
Superfamily Fibronectin type III 1.31e-42
Family Fibronectin type III 0.00062
Further Details:      
 
Domain Number 21 Region: 11846-12043
Classification Level Classification E-value
Superfamily Fibronectin type III 1.42e-42
Family Fibronectin type III 0.00063
Further Details:      
 
Domain Number 22 Region: 11159-11355
Classification Level Classification E-value
Superfamily Fibronectin type III 1.67e-42
Family Fibronectin type III 0.00095
Further Details:      
 
Domain Number 23 Region: 12928-13122
Classification Level Classification E-value
Superfamily Fibronectin type III 1.75e-42
Family Fibronectin type III 0.00058
Further Details:      
 
Domain Number 24 Region: 5833-6022
Classification Level Classification E-value
Superfamily Fibronectin type III 3.02e-42
Family Fibronectin type III 0.0008
Further Details:      
 
Domain Number 25 Region: 8700-8895
Classification Level Classification E-value
Superfamily Fibronectin type III 3.44e-42
Family Fibronectin type III 0.00029
Further Details:      
 
Domain Number 26 Region: 4021-4221
Classification Level Classification E-value
Superfamily Fibronectin type III 3.61e-42
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 27 Region: 1613-1809
Classification Level Classification E-value
Superfamily Fibronectin type III 6.29e-42
Family Fibronectin type III 0.00095
Further Details:      
 
Domain Number 28 Region: 13718-13907
Classification Level Classification E-value
Superfamily Fibronectin type III 7.31e-42
Family Fibronectin type III 0.00085
Further Details:      
 
Domain Number 29 Region: 6127-6318
Classification Level Classification E-value
Superfamily Fibronectin type III 1.56e-41
Family Fibronectin type III 0.00091
Further Details:      
 
Domain Number 30 Region: 2708-2907
Classification Level Classification E-value
Superfamily Fibronectin type III 2.2e-41
Family Fibronectin type III 0.00059
Further Details:      
 
Domain Number 31 Region: 14408-14600
Classification Level Classification E-value
Superfamily Fibronectin type III 2.34e-41
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 32 Region: 7515-7711
Classification Level Classification E-value
Superfamily Fibronectin type III 2.38e-41
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 33 Region: 2012-2201
Classification Level Classification E-value
Superfamily Fibronectin type III 3.67e-41
Family Fibronectin type III 0.00062
Further Details:      
 
Domain Number 34 Region: 14803-14992
Classification Level Classification E-value
Superfamily Fibronectin type III 4.22e-41
Family Fibronectin type III 0.00069
Further Details:      
 
Domain Number 35 Region: 15593-15787
Classification Level Classification E-value
Superfamily Fibronectin type III 6.17e-41
Family Fibronectin type III 0.00022
Further Details:      
 
Domain Number 36 Region: 4946-5044,5132-5233
Classification Level Classification E-value
Superfamily Fibronectin type III 2.7e-40
Family Fibronectin type III 0.00054
Further Details:      
 
Domain Number 37 Region: 3720-3915
Classification Level Classification E-value
Superfamily Fibronectin type III 2.74e-40
Family Fibronectin type III 0.00081
Further Details:      
 
Domain Number 38 Region: 15096-15293
Classification Level Classification E-value
Superfamily Fibronectin type III 3.99e-40
Family Fibronectin type III 0.00074
Further Details:      
 
Domain Number 39 Region: 15892-16074
Classification Level Classification E-value
Superfamily Fibronectin type III 4.06e-40
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 40 Region: 14010-14204
Classification Level Classification E-value
Superfamily Fibronectin type III 1.56e-38
Family Fibronectin type III 0.00058
Further Details:      
 
Domain Number 41 Region: 8310-8498
Classification Level Classification E-value
Superfamily Fibronectin type III 1.24e-36
Family Fibronectin type III 0.00056
Further Details:      
 
Domain Number 42 Region: 15296-15397,15486-15581
Classification Level Classification E-value
Superfamily Fibronectin type III 1.94e-36
Family Fibronectin type III 0.00012
Further Details:      
 
Domain Number 43 Region: 7716-7815,7905-7998
Classification Level Classification E-value
Superfamily Fibronectin type III 1.99e-36
Family Fibronectin type III 0.0000909
Further Details:      
 
Domain Number 44 Region: 5240-5340,5428-5522
Classification Level Classification E-value
Superfamily Fibronectin type III 4.53e-36
Family Fibronectin type III 0.00057
Further Details:      
 
Domain Number 45 Region: 6525-6721
Classification Level Classification E-value
Superfamily Fibronectin type III 7.82e-36
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 46 Region: 13126-13229,13316-13417
Classification Level Classification E-value
Superfamily Fibronectin type III 2.28e-34
Family Fibronectin type III 0.0000488
Further Details:      
 
Domain Number 47 Region: 14205-14309
Classification Level Classification E-value
Superfamily Fibronectin type III 2.31e-27
Family Fibronectin type III 0.0000417
Further Details:      
 
Domain Number 48 Region: 12004-12141
Classification Level Classification E-value
Superfamily Fibronectin type III 3.69e-27
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 49 Region: 9875-9984
Classification Level Classification E-value
Superfamily Fibronectin type III 1.71e-26
Family Fibronectin type III 0.0000215
Further Details:      
 
Domain Number 50 Region: 1812-1915
Classification Level Classification E-value
Superfamily Fibronectin type III 4.66e-26
Family Fibronectin type III 0.00039
Further Details:      
 
Domain Number 51 Region: 10946-11065
Classification Level Classification E-value
Superfamily Fibronectin type III 1.86e-25
Family Fibronectin type III 0.0000234
Further Details:      
 
Domain Number 52 Region: 14595-14712
Classification Level Classification E-value
Superfamily Fibronectin type III 2e-25
Family Fibronectin type III 0.00093
Further Details:      
 
Domain Number 53 Region: 4225-4320
Classification Level Classification E-value
Superfamily Fibronectin type III 3.96e-24
Family Fibronectin type III 0.0005
Further Details:      
 
Domain Number 54 Region: 8980-9088
Classification Level Classification E-value
Superfamily Fibronectin type III 1.86e-23
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 55 Region: 12443-12536
Classification Level Classification E-value
Superfamily Fibronectin type III 2.04e-23
Family Fibronectin type III 0.00048
Further Details:      
 
Domain Number 56 Region: 10276-10383
Classification Level Classification E-value
Superfamily Fibronectin type III 3.3e-23
Family Fibronectin type III 0.00049
Further Details:      
 
Domain Number 57 Region: 8592-8687
Classification Level Classification E-value
Superfamily Fibronectin type III 6.15e-23
Family Fibronectin type III 0.00098
Further Details:      
 
Domain Number 58 Region: 6041-6135
Classification Level Classification E-value
Superfamily Immunoglobulin 6.97e-23
Family I set domains 0.024
Further Details:      
 
Domain Number 59 Region: 6312-6439
Classification Level Classification E-value
Superfamily Fibronectin type III 1.11e-22
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 60 Region: 11360-11453
Classification Level Classification E-value
Superfamily Fibronectin type III 1.55e-22
Family Fibronectin type III 0.00085
Further Details:      
 
Domain Number 61 Region: 7008-7128
Classification Level Classification E-value
Superfamily Fibronectin type III 1.73e-22
Family Fibronectin type III 0.00041
Further Details:      
 
Domain Number 62 Region: 3519-3620
Classification Level Classification E-value
Superfamily Fibronectin type III 1.71e-21
Family Fibronectin type III 0.00075
Further Details:      
 
Domain Number 63 Region: 11754-11853
Classification Level Classification E-value
Superfamily Immunoglobulin 1.77e-21
Family I set domains 0.02
Further Details:      
 
Domain Number 64 Region: 12837-12934
Classification Level Classification E-value
Superfamily Immunoglobulin 2.7e-21
Family I set domains 0.01
Further Details:      
 
Domain Number 65 Region: 7830-7918
Classification Level Classification E-value
Superfamily Immunoglobulin 1.38e-20
Family I set domains 0.016
Further Details:      
 
Domain Number 66 Region: 277-371
Classification Level Classification E-value
Superfamily Immunoglobulin 1.39e-20
Family I set domains 0.0046
Further Details:      
 
Domain Number 67 Region: 9590-9689
Classification Level Classification E-value
Superfamily Immunoglobulin 8.5e-20
Family I set domains 0.0051
Further Details:      
 
Domain Number 68 Region: 2222-2312
Classification Level Classification E-value
Superfamily Immunoglobulin 1.91e-19
Family I set domains 0.01
Further Details:      
 
Domain Number 69 Region: 7424-7523
Classification Level Classification E-value
Superfamily Immunoglobulin 2.22e-19
Family I set domains 0.0089
Further Details:      
 
Domain Number 70 Region: 2912-3010
Classification Level Classification E-value
Superfamily Immunoglobulin 3.95e-19
Family I set domains 0.013
Further Details:      
 
Domain Number 71 Region: 11075-11167
Classification Level Classification E-value
Superfamily Immunoglobulin 4.72e-19
Family I set domains 0.01
Further Details:      
 
Domain Number 72 Region: 9993-10085
Classification Level Classification E-value
Superfamily Immunoglobulin 5.4e-19
Family I set domains 0.01
Further Details:      
 
Domain Number 73 Region: 15805-15900
Classification Level Classification E-value
Superfamily Immunoglobulin 7.71e-19
Family I set domains 0.031
Further Details:      
 
Domain Number 74 Region: 5352-5443
Classification Level Classification E-value
Superfamily Immunoglobulin 8.46e-19
Family I set domains 0.0059
Further Details:      
 
Domain Number 75 Region: 813-906
Classification Level Classification E-value
Superfamily Immunoglobulin 8.72e-19
Family I set domains 0.0069
Further Details:      
 
Domain Number 76 Region: 4649-4748
Classification Level Classification E-value
Superfamily Immunoglobulin 1.64e-18
Family I set domains 0.0055
Further Details:      
 
Domain Number 77 Region: 990-1083
Classification Level Classification E-value
Superfamily Immunoglobulin 2.78e-18
Family I set domains 0.0038
Further Details:      
 
Domain Number 78 Region: 8516-8607
Classification Level Classification E-value
Superfamily Immunoglobulin 2.93e-18
Family I set domains 0.0086
Further Details:      
 
Domain Number 79 Region: 13240-13331
Classification Level Classification E-value
Superfamily Immunoglobulin 3.14e-18
Family I set domains 0.017
Further Details:      
 
Domain Number 80 Region: 10677-10771
Classification Level Classification E-value
Superfamily Immunoglobulin 3.16e-18
Family I set domains 0.016
Further Details:      
 
Domain Number 81 Region: 8911-9003
Classification Level Classification E-value
Superfamily Immunoglobulin 3.19e-18
Family I set domains 0.031
Further Details:      
 
Domain Number 82 Region: 6735-6827
Classification Level Classification E-value
Superfamily Immunoglobulin 4.24e-18
Family I set domains 0.032
Further Details:      
 
Domain Number 83 Region: 1162-1248
Classification Level Classification E-value
Superfamily Immunoglobulin 5.77e-18
Family I set domains 0.0094
Further Details:      
 
Domain Number 84 Region: 539-622
Classification Level Classification E-value
Superfamily Immunoglobulin 6.21e-18
Family I set domains 0.022
Further Details:      
 
Domain Number 85 Region: 3931-4029
Classification Level Classification E-value
Superfamily Immunoglobulin 1.35e-17
Family I set domains 0.01
Further Details:      
 
Domain Number 86 Region: 6442-6532
Classification Level Classification E-value
Superfamily Immunoglobulin 1.42e-17
Family I set domains 0.021
Further Details:      
 
Domain Number 87 Region: 457-545
Classification Level Classification E-value
Superfamily Immunoglobulin 2.55e-17
Family I set domains 0.024
Further Details:      
 
Domain Number 88 Region: 12158-12250
Classification Level Classification E-value
Superfamily Immunoglobulin 4.77e-17
Family I set domains 0.042
Further Details:      
 
Domain Number 89 Region: 15011-15103
Classification Level Classification E-value
Superfamily Immunoglobulin 5.13e-17
Family I set domains 0.01
Further Details:      
 
Domain Number 90 Region: 14323-14414
Classification Level Classification E-value
Superfamily Immunoglobulin 5.62e-17
Family I set domains 0.0099
Further Details:      
 
Domain Number 91 Region: 5751-5840
Classification Level Classification E-value
Superfamily Immunoglobulin 1.37e-16
Family I set domains 0.017
Further Details:      
 
Domain Number 92 Region: 367-455
Classification Level Classification E-value
Superfamily Immunoglobulin 1.46e-16
Family I set domains 0.0072
Further Details:      
 
Domain Number 93 Region: 15411-15500
Classification Level Classification E-value
Superfamily Immunoglobulin 8.64e-16
Family I set domains 0.016
Further Details:      
 
Domain Number 94 Region: 13636-13725
Classification Level Classification E-value
Superfamily Immunoglobulin 8.95e-16
Family I set domains 0.0065
Further Details:      
 
Domain Number 95 Region: 1350-1438
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000101
Family I set domains 0.02
Further Details:      
 
Domain Number 96 Region: 11474-11564
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000156
Family I set domains 0.022
Further Details:      
 
Domain Number 97 Region: 893-985
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000045
Family I set domains 0.016
Further Details:      
 
Domain Number 98 Region: 3639-3727
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000472
Family I set domains 0.0079
Further Details:      
 
Domain Number 99 Region: 188-273
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000712
Family I set domains 0.0074
Further Details:      
 
Domain Number 100 Region: 1525-1620
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000212
Family I set domains 0.0088
Further Details:      
 
Domain Number 101 Region: 5058-5144
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000225
Family I set domains 0.0093
Further Details:      
 
Domain Number 102 Region: 10393-10481
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000241
Family I set domains 0.018
Further Details:      
 
Domain Number 103 Region: 725-810
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000266
Family I set domains 0.015
Further Details:      
 
Domain Number 104 Region: 14721-14809
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000027
Family I set domains 0.011
Further Details:      
 
Domain Number 105 Region: 13925-14018
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000034
Family I set domains 0.014
Further Details:      
 
Domain Number 106 Region: 3213-3247,3276-3332
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000611
Family I set domains 0.02
Further Details:      
 
Domain Number 107 Region: 1259-1340
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000925
Family I set domains 0.023
Further Details:      
 
Domain Number 108 Region: 12559-12646
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000131
Family I set domains 0.031
Further Details:      
 
Domain Number 109 Region: 4343-4442
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000022
Family I set domains 0.0064
Further Details:      
 
Domain Number 110 Region: 104-184
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000804
Family I set domains 0.014
Further Details:      
 
Domain Number 111 Region: 8227-8317
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000827
Family I set domains 0.023
Further Details:      
 
Domain Number 112 Region: 7140-7228
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000166
Family I set domains 0.023
Further Details:      
 
Domain Number 113 Region: 1929-2018
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000193
Family I set domains 0.016
Further Details:      
 
Domain Number 114 Region: 9312-9399
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000025
Family I set domains 0.026
Further Details:      
 
Domain Number 115 Region: 14-95
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000635
Family I set domains 0.024
Further Details:      
 
Domain Number 116 Region: 1432-1514
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000037
Family I set domains 0.021
Further Details:      
 
Domain Number 117 Region: 638-720
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000565
Family I set domains 0.00038
Further Details:      
 
Domain Number 118 Region: 1082-1164
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000462
Family I set domains 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012695   Gene: ENSMODG00000010118   Transcript: ENSMODT00000012926
Sequence length 16075
Comment pep:novel chromosome:BROADO5:4:190761681:191025497:-1 gene:ENSMODG00000010118 transcript:ENSMODT00000012926 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TISLSYIPGAVVEFVKELQDIEVPESFSGELECIISPENVEGKWYHGDVELKSNGKYTIT
SRRGRQNLTVKDVTKEDQGEYSFVVDGKKTSCYLKMKRGAISKPLTDQTVAESQEAVFEC
EVANPDSEGEWLKDGKHLTLSNNIKSEAEHHKRRLIIVATKLDDIGEYTYKVATSKTSAK
LKVEAVKIIIKPKDVTALENATVAFEVSVSHDTVPVKWFHKNVEIKPSDKHRLVSERKVH
KLMLQNIAPSDAGEYTAVVGQLECKAKLFVETRHIEFRKHIKDIKVLEKKRAMFECEISE
PDITVQWMKDGTALSSSPNCKISDADNKHILELSNLTTQDRGIYSCKASNKFGADICQAE
LIIIDKPHFIKELESVQSAVNKKVHLECQVDEDRKVTITWSKGTEKLESSPKYEISIEGD
RHILTVKDCQLKDQGNYRLVCGPHIASAKLTVIGKEPTWERHLQDVTLKEGQTCTMTCQF
SVPNVKSEWFRNGKILKPQPRYKTEVEHKVHKLSIADVRAEDQGRYTCKYEGLETSAELK
IEAEPIQFTRRIQNIVVSEHQSATFECEVSFDDAIVTWYKDGNNIRESPKHRFIADGKDR
KLHIIDVQLSDAGEYTCVLRLGNKVSPLLIPDREVDLLKPIEDVTVYEKESASFDAEISE
PDVPGEWKLKGEVLRPSPTCEIKTDGGKRFLTLHKVKLDQAGEVSYQAFNAFTAAILTVK
GIRLKFMSPLEDQTVKEGETATFVCELSHEKMHVTWFKNDVKLHTSRTVLISSEGKTHKL
EMREVTLDDISQIKAQVKNLNSTAHLKVLEADPYFTVKLHDYTGTEKDEIVLKCEVSKDV
PVKWFKDGEEITPSTKYSIKTDGLRRILKIKKTELKDKGEYSCDCGTDVTKANVNVEELP
LIFITPLSDVKVFEKDEAKFECEVSREPKTFRWLKGTQEITSDDKVELIKDGTRHSMVIK
SAAFEDEGKYMFEAEDKRTSGKLIIEEGDPYFTGKLQDYTGVEKDEVVLQCEISKADAPV
KWFKDGKEITPSKNVVIKADGKKRMLILKKALKSDIGQYTCDCGTDKTSAKLDIEDREIK
LVRPLYSVEVIETETARFETEISEEDIHANWKLKGEPLLQTPDCEIKEEGKMHFLILHNC
RLDQTGGVDFQAANVKSSAHLRVKRKWHILIPLEDQTVEEEATAVLECEVSRENAKVKWF
KNGTEILKSKKYEIVADGRVRKLIIHNCTPEDIKTYTCDAKDFKTSCNKFVICRLSFSEK
LRIIVPLKDTRVKEQQEVVFNCEVNTEGAKAKWFRNDEAIFDSSKYIILQKDLVYTLRIR
DARLDDQATYSVSLTNHRGENVKIEEDLRIVEPLQDIETMEKKSVTFWCKVNRLNVTLKW
TRNGEEIPFDNRVLYRVDKYKHSLIIKDCGFPDEGEYTVYAGQDKSVAELLIIEAPTEFV
EHLEDILEAPGADVVFFAELNKDKVEVQWLRNNMIVVQGDKHQMMSEGKIHRLQICDIKP
RDQGEYRFIAKDKEARAKLELAAAPKIKTDDQDLVVDVGQPLTMVVPYDAYPKAEAEWFK
ENEALPSKTVDTTADQTSFRILEAKTSDKGRYKVVLQNKHGKAEAFINVKVIDVPGPVRN
LEVTETFDGEVSLAWEEPLSDGGSKIIGYVVERRDIKRKTWVVATDRADSCEYTVTGLQK
GGVEYLFRVSARNRVGTGEPVETDNPVEARSKYDVPGPPLNVAITDVNRFGVSLTWEPPE
YDGGCEITNYVIELRDKTSIRWDTAMTVRAEDLSATVTDVVEGNEYSFRVRAQNRIGVGK
PSAATPFVKVADPIERPSPPINLASSDQTQSSVQLTWEPPLKDGGSPILGYIIERCEEGK
DNWIRCNMKLVPELTYKVTGLKQGNKYLYRVSAENEAGISDPSDILGPLTADDAFVEPTM
DLSQFKDGLEIIVPNPIKILVPSTGYPRPTATWSFGDQVLEASDRVKMKTLSAYAELVIS
PSERPDKGIYTLQLKNPVTAISGEIDVNVIARPSAPKELKYGDITRDSVHLTWEPPDDDG
GSPLTGYLIEKREVSRKTWTKVMDFVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYV
DEPVNMSAPATVPDPPENLKWRDRTAKSIFLTWEPPKYDGGSRIKGYIVEKCPRGSDKWV
ACGEPVAETKMEVTGLEEGQWYAYRVKALNRQGASKPCKPTDDIQAVDSQEAPEIFLDVK
LLAGLTVKAGTKIELPATVTGKPEPKITWTKADVILKQDKRITIENVPKKSTVTIVDSKR
SDTGTYIIEAVNVCGRATAVVEVNVLDKPGPPAAFDISEVTNESCLLTWNPPRDDGGSKI
TNYVVERRATDSEVWHKLSSTIKDTKFQATKLIPNKEYLFRVAAENMYGVGEPVQASPIT
AKYPFDPPGPPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWVERLDPDTDKWVKCNKM
PIKDTTYRVKGLTNKKKYRFRVLAENLAGPGKPSRSTEPILVKDPIDPPWPPGKPTVKDI
GKTSLLLNWTKPEHDGGAKIESYVIEMLKTGTDEWVRVAEGVPTTEHFLRGLMEGQEYSF
RVRAVNKAGESEPSEPSDPVLCREKLYPPSPPRWLEVINITKNTADLKWTVPEKDGGSPI
TNYIVEKRDVRRKGWQTVDTTVKDTKCTVTPLTEGSLYVFRVAAENAIGQSDYCEIEDSV
LAKDTFTTPGPPYALAVVDVTKRHVDLKWEPPKNDGGRPIQRYIIEKKEKLGTRWVKAGK
TSGPDCNFRVTDVIEGTEVQFQVRAENEAGIGHPSEPTEIIAIEDPTSPPSPPLDLHVTD
AGRKHIAIAWKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPVKDLKFKVEEGVVPDKE
YVLRVRAVNAVGVSEPSEISENVVAKDPDCRPTIDLETHDIVVIEGEKLNIPVPFRAVPT
PTITWHKDGKELKANDRLTMKSDHISAHIEVPKSVHADAGVYTITLENKLGSTTGSINVK
VIGLPGPCKDIKASDITKSSCKLTWEPPEYDGGSPILHYVLERREAGRRTYIPVMSGENK
LSWTVKDLIPNGEYFFRVKAVNKIGGGEYIELKNPVIAQDPKQPPDPPIDVEVHNPTAKS
MTLTWKPPLYDGGSKIMGYIIEKIAKGEDKWKRCNDFLVPVLTYTVKGLEEGKEYQFRVR
AENAAGISEPSRATPPVKAVDPIDAPKVILRTTLEVKRGEEISLDATISGSPYPTITWLK
DEEVIRPEEIKKRPTTVVRRKKGEVQEEEPFVLPLTERLSIDNSKQGESQLRVRDSLRPD
HGMYMIKVENDHGTAKAPCVVSVLDTPGPPINFVFEDVRKNSVTCKWEPPLDDGGSEIIN
YTLEKKEKTKSDADWIVVTSTLRHCKYSVPKLIEGKEYVFRVRAENRFGPGPPCVSKPLL
AKDPFEPPDAPDKPLVEDVTSNSMLVKWNEPKDNGSPILGYWLEKREVNSTHWSRVNRNL
LSSLKTKVDGLLEGLTYVFRVCAENAAGPGKFSPPSDPQTARDPISPPGPPVPRVTDTST
TTIELEWEPPAYNGGGEIIGYFVDKQLVGTNEWSRCTEKMIKVRQYTVKEIREGADYKLR
VSAVNIAGEGPPGETEPVTVAEPQEPPTVELDLSVKAGIQIMAGQTLKIPAIVTGRPIPT
KVWTKEEGELDKDRVVIDNVGTKSDLIIKNALRKDHGRYVITATNSCGSKFAAARVEVFD
VPGPVLDLKPVVTNRKMCLLNWSDPADDGGSEITGFIIERKDAKMHTWRLPIETDRSKCD
ITGLIEGQEYKFRVIAKNKFGCGPPVEIGPILAVDPLGPPTAPERLTYTERTKSTITLDW
KPPRTDNGSPIQGYIIEKRRHDKPDFERVNKRLCPTTSFLVEDLDEHQMYEFRVRAVNGV
GESEPSLPLNVVIQDDEVPPTIKLRLKVRGDTIKVKAGEPVNIPADVTGLPMPKIEWSKN
EKVIEKPTDALQITKEEVSRSEAKTELSIPKAVREDKGTYTVTASNRLGTVFRNVHVEVY
DRPSPPRNLQVVDIKAESCHLTWDAPLDNGGSEITHYVIDKRDASRKKTEWEEVTNTAVE
RRYGVWKLIPNGQYEFRVRAVNKYGTSDECKSDKVVIQDPFRTPGPPGKPKVLERTKGSM
LVSWTPPLDNGGSPITGYWLEKREEGGSYWSRVSRAPITKTGLKGLEFNVPRLIEGVKYQ
FRALAINAAGVGPPSEPSDPALAGDPIFPPSPPSCPEVKDRTKSTITLGWKPPVKDGGSP
VKGYIVEMQEEGTTDWKKVNEPDKLITTCEYVVPNLKELRKYRFRVKAVNDAGESEPSGT
TGEIPATDIQEPPEVFIDIGAQDSLICRAGSQIKIPAIIKGRPTPKSSWEFEGKAKKTVK
ESVHNIPEDAQVETAENSSVIIINDCKREHSGKYSITAKNKAGQKTANCRVKVMDVPGPP
KDLKVSDITRSSCKLSWKMPDDDGGDRIKGYVIEKRTVDGKAWTKVNPNCGSTSFVVPDL
ISEQQYFFRVRAENRFGIGAPVETIQRTTARDPIYPPDPPIKLKIGLVTKDTVSLTWKPP
KNDGGAPVTHYIVECLAWDPTGKKKEAWKQCNRRDVEETKFTVEDLIEGGEYEFRVKAVN
EAGVSKPSATVGPIIVKDQTCPPSIDLKEFMEVEEGTDVSIVAKVKGVPFPTLTWFKAPP
KKPDDKTPVLYDHHINKLVVDDTCTLVIPQSRRSDTALYTLTAENNLGTASKEMRLNVLG
RPGPPVGPIKFESISADQMTLSWLPPLDDGGSKITNYVVEKREANRKTWVRVSSEPKECT
YTIPKLLEGHEYVFRIMAQNKYGIGEPLDSEPETARNLFSVPGAPDKPTVSSVKRDSMTV
NWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQFRV
YAINAAGVGPASMPSDPVTARDPIAPPGPPFPKVTDWTKSSVDLEWTPPLKDGGSKITGY
IVEYKEEGKEEWEKGKDKEVRGTKLVVPGLKEGAFYKFRVRAVNIAGIGEPGEATDIIEM
KDRIVLPDLQLDASVRDRIVVHAGGVIRIIAYVSGKPPPTVTWNMNERALPEEANIETTA
ISSSMVIKNCKRSHQGVYSLLAKNAGGERKKTIIVDVLDVPGPVGIPFLSDNLTNDSCKL
TWFSPEDDGGSPITNYVIEKREADRRAWTPVTYTVTRQNATVQGLIEGKSYFFRIAAENS
IGMGPFVETQNALVIRDPMTVPERPEDLEVKEVTKDSVSLTWNPPKYDGGSEIINYVLES
RLIGTEKFHKVTKDNLLSRKYTVKGLKEGDTYEYRVSAVNIIGQGKPSFCTKPITCKDEL
APPTLELDFRDKLIVRVGEAFVLTGRYSGKPKPKVTWLKDETDVLEDDRTQIKTTPTTLS
LGKVKAKRADSGKYTVIVENSTGSRKGSCQVAVVDRPGPPVGPVIFDEVHKDHFIISWKP
PLDDGGSEITNYIIEKKELSKDVWIPVTSASIKTTCKVPKLLEGKDYVIRIYAENLYGIS
DPLVSDSMKAKDRFSVPAAPDQPIVTEVTKDSALVTWNKPYDGGKPITTYIVEKKETRSK
KWVRVSREPIHPYTKFRVPDLVEGCQYEFRVSAENEIGVGDPSPPSKPVFAKDPIAKPSP
PINPEAVDTTKNSVDLTWQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPETCPETKYK
VTGLRDGQTYKFRVMAVNEAGESDPAHVPEPVLVRDRLEPPELILDANMAREQHIMVGDT
LRLSAIIKGVPFPKVTWKKEDREVPIKAQIDVTPVGSKLEIRNSAHEDGGIYSLTVENPA
GSKTVSVKVVVLDKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSDITNYVVERRDVATAQ
WSPLSTTSKKKSHLAKHLNEGNQYLFRVAAENQYGRGPFVETPKPIKAMDPLQPPGPPKD
LHHVDVDKTEVSLVWTKPDRDGGSPITGYLVEYQQDGTEDWIKFKTVTDLACVVTGLQQG
KIYRFRVKAQNIVGLSLPDTTIPIECQEKLVPPSVELDVKLIEGLVVKAGTTVRFPAIIR
GVPTPTAKWTTDGSEIKSDDHYHIETDSFSSVLTIKNCLRKDTGEYLITVTNAAGSKTVA
VHLTVLDVPGPPTGPIDILDVTPEHMVIAWRPPKDDGGSPVINYIVEKQDTRKDTWGVVS
AGSSKTKLKVPHLQKGNEYIFRVRAENKMGVGPPLDSTPTVAKHKFNPPSPPGKPVVTDI
TENAATVSWTLPKSDGGSPITGYYVERREMTGKWVRVNKTPIADLKFRVTGLYEGNTYEF
RVFAENLAGLSNPSPSSDPIKACRPIKPPGPPINPKLKDKTKETADLVWTKPLSDGGSPI
LGYVVECQKPGTAQWNRINKDELIRQCAYRVPGLIEGNEYRFRIKAANIVGEGEPRELAE
SVIAKDILHPPEVELDVTCRDIITVRVGQTIRILARVKGRPEPDITWSKEGKVLVREKRV
DLIHDLPRVELQIKEAVRSDHGKYIISAKNSSGHAQGSAIVNVLDRPGPCQNLRITSVTK
ENCTVSWENPLDNGGSEITNFIVECRKPNQKGWSIVSSDVTRRLVKANLLANNEYYFRVC
AENKVGVGPTIETKTPILAINPIDRPGEPENLHIAEKGKTFVYLKWRRPDYDGGSPNLSY
HVERRLKGSADWERVHKGSIKDTHYMVDKCVENQIYEFRVQTKNEGGESDWVRTEEVVVK
EDLQKPVLELKMSGVLTVKAGDTIKLEAAVRGKPFPEVSWTKDKDATDLTRSPRAKIDTS
SESSKFTLTKAKRSDGGKYVITATNTAGSFVAYATVNVLDKPGPVRNLKISDVSSDRCTI
RWDPPDDDGGCEIQNYILEKCESKRMVWSTYSANVLTPSATVTRLIEGNEYIFRVRAENK
IGTGPPTESKPVIAKTKFDRPGRPDPPEVTKVSKEEMTVVWNPPEYDGGKSITGYILEKK
EKHSVRWVPVTKSAIPERRMKVQNLLPGHEYQFRVKAENEIGIGEPSLPSKPVVAKDPIE
PPGPPTNLKVVDTTKNSITLGWGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKRCNAAA
QLIRKEFTATSLDENQEYEFRVCAQNQVGIGRPAELKDAIKPKEILEPPEIDLDASMRKL
VVVRAGCPIRLFAIVRGRPAPKVTWRRVGIDNVVRKGQVDLVDTMAFLVIPDSTRDDSGK
YSLTLVNPAGEKAVFVNVRVLDTPGPVSDLKASDATKTSCHVSWAPPENDGGSQVTHYIV
ERREAERKTWATVTPEVKKTSFQVTNLVPGNEYFFRVTAVNEYGPGVPTDIPKPVLASDP
LSEPDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGYIISYREEEQPADRWTEYSIVKD
LSLVVTGLKEGKKYKFRVVARNAVGVSLPREADGVYEAKEQLLPPKILMPEQVTIKAGKK
LRIEAHVYGKPQPICTWKKGEEPVVTSSRLAVHKADASSVLILKDVTRKDSGYYNLTAEN
SSGSDTQKIKVVVMDAPGPPQPPFDISEIDADACSLSWHIPLEDGGSNITNYVVEKCDVS
RGDWVTALASVTKTSCRVGKLIPGQEYIFRVRAENRFGISEPLQSPKMLAKFPFDVPSEP
KNARVTKVNKDCIFVAWDRPDSDGGSPITGYLIERKERNSLLWVKANDTLVRSTEYPCAG
LVEGLEYSFRIYALNRAGSSLPSKPTEYVTARMPVDPPGKPEVIDVSKNSVSLIWARPKH
DGGSKIIGYFVEACKLPGDKWVRCNTTPHQIPQEEYTATGLEENAQYQFRAIAKTAVNIS
QPSEPSDPVTILAENVPPRIELSVAMKSLLTVKAGTNVCLDASVFGKPMPTISWKKDGIP
IKASDVIKMATKRNLCTLELFCVNRKDSGDYTITAENSSGSKSATIKLKVLDKPGPPASV
KINRMYADRAMLSWEPPLEDGGSEITNYIVDKRETSRPNWAQVSPNVPITSCSVEKLIEG
HEYQFRICAENKYGVGDPILTEPAIAKNPYDPPGRCDPPVISNVMKDHMTVSWKPPADDG
GSPITGYLLEKRETQAVNWTKVNRKPIIERTIKATGLQEGTEYEFRVTAINKAGPGKPSD
ASKAVYAQDPLYPPGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNW
VRCNLPENLKKTRFDVTGLMENTEYQFRVYAVNKIGYSDPSDVPDKHIPKDILIPPEGDL
DADLRKTLILRAGVTMRLYVPVRGRPPPKITWSKPNVNLRERIGLDIKSTDFDTFLRCEN
VNKYDAGKYILTLENSCGKKEYTIVVKVLDTPGPVLNLRPTEITKDSVTLHWDLPLIDGG
SRITNYIVEKREATRKSYSTATTKCHKCTYKVTGLSEGCEYFFRVMAENEYGVGEPTETT
EPVRASEAPSPPDSLNIMDITKSTVSLAWPKPKHDGGSKITGYVMKPREKALTMDSHHTC
KIRMCVKTYRKGEEYTFQVMAVNSAGRSAPRESRPVIVKEQTMLPELDLRGIYQKLVIAR
AGENIKVEIPVLGRPKPTVTWKKGDQLLKQTQRVNFENTATSTILNINECTRSDSGPYPL
TAKNIVGEVGDIITIQVHDIPGPPTGPIKFDEVSSDFVTFSWEPPENDGGVPISNYVVEM
RQTDSTTWVELATTVIRTTYKATRLTTGVEYQFRVKAQNRYGVGPGITSASVVANYPFKV
PGPPGTPQVTAVTKESITISWHEPLTDGGSPILGYHVERKERNGILWQTVSKALVPGNIF
KSSGLTDGIAYEFRVIAENMAGKSKPSKPSEPTLALDPIDPPGKPIPLNITRHTVTLKWA
KPEYTGGFKITSYIVEKRDLPNGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAKNAAG
AISPPSEPSDAITCRDDIEAPRIMVDVKYKDTLTLKAGEVFKLEADVSGRPPPTMEWTKD
GKELEGTAKLEIKTADFSTNLVNKDSSRRDSGAYVLTATNPGGFAKHIFNVKVLDRPGPP
EGPLAVTEVTSEKCVLSWLPPRDDGGASIDYYVVQKRETSRLAWTNVASDVQLTKLKVTK
LLKGNEYVFRVMAVNKYGVGEPLESEPVLAVNPYGPPDPPKNPEVTAITKDSMVVCWGHP
DSDGGSEIINYIVERRDKSGQRWVKCNKRAVTDLRFKVSGLTEGHEYEYRIMAENAAGIS
APSATSPFYKACDTVFKPGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVEIALPE
EDEWKIVTPPAGLKATSYTITNLKENQEYKIRIYAMNSEGIGEPALVPGTPKAEERMLPP
EIELDADLRKVVTIRACCTLRLFVPIKGRPAPEVKWAREHGESLDKASIESTSSYTLLIV
GNVNRFDSGKYMLTVENSSGSKTAFVNVRVLDTPGPPQDLKIKEVTKSSVTLTWEPPLLD
GGSKIKNYIVEKRESTRKAYSTVATNCHKTSWKVDQLQEGCNYYFRVLAENEYGIGLPAE
TAESVKVSERPLPPGKITLLDVTRNSVSLSWEKPEHDGGSRILGYIVEMQSKGSDKWATC
ATVKVTEATITGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLVIPPAFKLLFNTFT
VLAGEDLKVDVPFIGRPTPTVTWHKDDLPLKQTTRVNAESTENNTLLTIKEACREDVGHY
MVKLANSAGEATEILNIIVLDKPGPPTGPVKMDEVTADSITLSWEPPKYDGGSSINNYIV
EKRDTSTTTWQIVSATVARTTIKACRLKTGCEYQFRIAAENRYGKSTYLTSEPIVAQYPF
KVPGPPGTPFVTTSSKDSMEVQWNEPVNDGGSKVIGYHLERKERNSILWVKLNKTPIPQT
KFKTTGLEEGIEYEFRVCAENIVGIGKPSKVSECYVARDPCDPPGRPEAIIVTRNSVTLQ
WKKPTYDGGSKITGYIVEKKELPDGRWMKASFTNIIETQFEVTGLVENQRYEFRVIARNA
AGVFSEPSESTGAITARDEVDPPRISMDPKYKDTIVVHAGESFRIEADVYGKPVPTIQWT
KGDQELSNTAHLEIKSTDFATCLNVKEAARVDSGNYVLKAKNVAGERSVTVNVKVLDRPG
PPEGPVVVSGVTAEKCTLAWKPPLQDGGSDIINYIVERRETSRLVWTIVDANVQTLSCKV
TKLLEGNEYIFRIMAVNKYGVGEPLESEPVMAKNPFVVPDAPKAPEVTTVTKDSMIVVWE
RPASDGGSEILGYVLEKRDKEGIRWTRCHKRLIGELRLRVTGLIENHDYEFRVSAENAAG
LSEPSPPSAYQKACDPIYKPGPPNNPKVTDVTRSSVFLSWSKPVYDGGSEIQGYIVEKCD
VSVGEWTMCTPPTGIKKTNIEVEKLLEKHEYNFRICAVNKAGVGEHADVPGPILVEEKLE
APDIDLDLELRKVINIRAGGSLRLFVPIRGRPAPEVKWGKMDGEIRDAALIDVTSSFTSL
VLENVNRYDSGKYTLTLENSSGTKSAFVTVRVLDTPSPPINLKVTEITKDSVSITWEPPL
LDGGSKIKNYIVEKREATRKSYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYGIGLP
ARTADPIKVAEVPQPPGKITVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSDKWS
ECARVKNLEAVITNLTQGEEYLFRVVAVNEKGRSDPRSLAVPVIAKDLVIEPDVRPAFNS
YSIQVGQDLKIEVPISGRPKPAITWTKDGQPLKQTTRLNVTDLPDLTVLSIKETHKEDGG
MYGITVANVVGQKSASIEIITLDKPDPPRGPVKFDEVSAESITLSWNPPLYTGGCQITNY
IVQKRDTTSTVWELVSGTVARTTLKVTKLKTGTEYQFRIFAENRYGQSFALESDPVVAQY
PYKEPGPPGTPFVNAISKDSMVVQWHEPINNGGSPVIGYHLERKERNSILWTKVNKTIIH
DTQFKALNLEEGIEYEFRVYAENIVGIGKASKSSECYVARDPCDPPGTPEAVMVKRNEIT
LQWTKPVYDGGSMITGYIVEKRDLPEGRWMKASFTNVIETQFTVTGLTENEKYEFRVIAK
NAAGAVSKPSDSTGAITAKDEVELPRISMDPKYRDTIVVNAGETFRLEADVYGKPLPTIE
WLKGDKEVEESARCEIKNTDFKALVIIKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDR
PGPPEGPIQVTGVTSEKCSLAWSPPLQDGGSDISHYIVEKRETSRLAWTVVAPEVVTNTL
KVTKLLEGNEYIFRVMAVNKYGVGEPLESAPVLMKNPFVLPGPPKSLEVTNIAKDSMTVC
WNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAENA
AGVGEPSQATVYYKACDPVFKPGPPTNAHLVDTTKNSITLAWSKPIYDGGSEILGYLVEI
CKADEDEWKVVTPQTGLRVTRFEISKLIEHQEYKIRVCALNKVGLGEPASLPGTVKPEDK
LEPPELDLDSELRKGIVVRAGGSARIHIPFKGRPTPDITWSREEGEFTDKVQIEKGLNYT
QLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKVLDTPGPPQNLAVKEVNKDSVTLVWEP
PLIDGGAKIKNYVIDKRESTRKAYANVSAKCNKTNFKVENLTEGAIYYFRVMAENEFGVG
VPVETLDAVKAAEPPSPPGKVTLTDVSQTSASLMWEKPEHDGGSRVLGYVVEMQPKGTEK
WSVVAESKVCNAVISGLSSGQEYQFRVKAYNEKGKSDPRVLGVPVIARDLTIQPSFKLPF
NTYSVQAGEDLKIEIPVIGRPRPKVSWVKDGETLKQTTRVNVEETATSTILHIKESNKDD
FGKYTITASNSAGTTTEDLSIIVLEKPGPPVGPVRFDEVSADFVVISWEPPIYTGGCQIS
NYIVEKRDTTTTTWQMVSATVARTTIKITKLKTGTEYQFRIFAENRYGMSPSLDSKPIVV
QYPFKEPGPPGTPFVTSISKDQMLVQWHEPVNDGGSKVIGYHLEQKEKNSILWVKLNKIP
IQDTKFKTTGLDEGLEYEFKVSAENIVGIGKPSKVSECFVARDPCDPPGRPEAIVITRNF
VTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASFTNVLETEFTVSGLVEDQRYEFRVI
ARNAAGNFSEPSESTGAITARDEIDAPNASLDPKYKDVIVVRAGETFVLEADIRGKPIPD
IVWIKDGKELEEATARMEIKSTIQKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITVKV
LDRPGPPEPPLKVSGVTAEKCYLAWNPPLQDGGANISHYIIEKRETSRLSWTQVSNEVQA
LNYKVTKLLPGNEYIFRVMAVNKYGIGEPLESEPVIACNPYKPPGPPSVPEVSAITKDSM
IVTWARPVDDGGAEIEGYILEKRDKDGIRWTKCNKKTLTDLRFRVTGLTEGHSYEFRVAA
ENAAGLGEFSEPSVFYRACDALYPPGPPSNPKVTDTSRSSVSLAWNKPIYDGGAPVKGYV
VEVKEAAADEWTTCTPPSGLQGKQFTVTKLKENSEYNFRICAINSEGVGEPATIPGSVVA
AERIEPPEIELDADLRKVVILRASATLRLFVTIKGRPEPEVKWEKAEGTLTERAQIEVTS
SYTMLVIDNVTRFDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLTVREVKKDSVTLS
WEPPLIDGGAKITNYIVEKRESTRKAYATITNNCTKTTFKIENLQEGCTYFFRVLASNEY
GIGLPAETKEPVKVSEPPLPPGRVTLVDVTRNTATIKWEKPESDGGSKITGYVVEMQTKG
SEKWSTCTHVKTLEATISGLTTGEEYTFRVAAVNEKGKSDPRQLGVPVVAKDIEIKPSVE
LPFNTFNVKAGDQLKIDVPFSGRPVPTVSWKKDGQTLKETTRVNVQSSKTVTSLIIKEAS
REDVGKYELSVSNSAGTTTVSITVIVLDRPGPPGPIHIDEVSSDNVTISWNPPEYDGGCQ
ISNYIVEKRDTTSTTWQVVSQAVARTSIKIIRLTTGSEYQFRVCAENRYGKSTYSESSPV
IAEYPFSPPGPPGTPKVVHATKSTMIVSWQVPVNDGGSQVIGYHLEHKERSSILWTKVNK
TLITDTQMKVSGLDEGLMYEYRVYAENIAGIGKCSKACEPVPARDPCDPPGQPEVTNITR
KSVSLKWAKPRYDGGAKITGYLIERRELPDGRWLKCNFTNVQETYFEVTELTEDQRYEFR
VFARNAADSVSEPSESTGPITVKDDIEAPRIMMDVRFRDIIVVKAGEVLKINADISGRPL
PVISWSKDGKEIEERAKIEIVSTDSTTLLTVKDCVRRDTGQYVLTLKNVAGTRSMAVNCK
VLDRPGPPAGPLEINGLTAEKCSLSWGPPQEDGGADIDYYIVEKRETSRLAWTICEEELR
TTSCKVTKLLRGNEYIFRVIGVNKYGVGEPLESVAVKALDPFTIPDPPTSLEITSVTKDF
MTLCWSRPESDGGSDISGYIIERREKNSLRWVRVNKKPVYDLRVKSTGLREGCEYEYRVY
AENAAGLSLPSETSPLVRAEDPVFLPSPPSKPKIVDSGKTNITIGWIKPLFDGGAPVTGY
TVEYKKSDETDWSVAIQSLRGTEYTVSGLTSGTEYVFRVRSINKVGASDPSESSDPQVAK
EREEEPVFDLDSEMKKTLIVKAGSSFTMTVPFRGRPIPNVIWSKPDTDLRTRASIDSTDT
RTSLTIENANRNDSGKYTLTIQNILNAASLTLVVKVLDSPGPPANINVKDVTKESAVLSW
DVPENDGGAPVKNYHIEKREASKKAWVTVTNNCNRLSYKVSNLQEGAVYYFRVSGENEFG
VGVPTETKEGVKITEKPSPPEKLGVESVSKDSVSLMWLKPEHDGGSRIVHYIVEALEKGQ
KNWVKCAVVKATRHTVSSLRENSEYFFRVFAENQAGVSDPRELLLPVLVKDQLEPPDIDM
TNFPSNTVYIRAGSNLKVDIPISGKPLPKVTLSKDGIPLKATMRFNTEITAENLTINLKE
SVATDAGRYEITASNASGTTKAFINIIVLDRPGPPSGPVVISDVTEDSVILKWQPPKYDG
GSQVTNYIVLKRETSTAVWTEVSATVARSMMKVMKLTTGEEYQFRIKAENRFGISDHTDS
ACVTVKLPYTTPGPPSTPWVTNVTRESITVGWHEPVSNGGSAVIGYHLEMKDRNSILWQK
ANKMVIRTTHFKVSTISAGLIYEFRVYAENAAGIGKASHPSDPVLAIDACEPPRNVRITD
ISKTSVNLSWQKPAFDGGSKITGYIVEKRDLPDGRWTKASFTNVIETQFTVSGLTQNSQY
EFRVFAKNAVGSISNPSEVVGPITCIDTYVPPTVEFGPECFDGLIIKAGESLRIKALIKG
RPVPRVTWFKDGQEIEKKMNMEITDVLGSSSLFVRDATRDHRGVYTVEAKNISGSTKEDI
TVKVQDTPGKVVGPIRFTNITGEKMTLWWDAPLNDGCSPVTHYMIEKRETSRLAWALIED
KCEAHSYTAVKLINGNEYQFRVSAVNKIGVGRPLDSDPVVAQIQYTVPDAPGTPEPSNIT
GNSITLTWARPESDGGNEIQHYILERREKKSMRWVKVISKRPITETRFKVTGLTEGNEYE
FHVMAENAAGVGPSSGISRLIKCREPVSPPGAPTVVKVTDTSKTTVSLEWTKPVFDGGME
IIGYIIEMCKADLGEWQKVNAEACVKTRYTVTNLQAGEEYKFRVSAVNGAGKGESCEVSG
TIQAVDRLTPPELDIDANFKQTHIVRAGASIRLFIAYRGRPTPTAVWSKPDSNLSIRADI
HTTDSFSTLTVENCNRNDAGKYTFSLENNSGSKSITFTVKVLDSPGPPGPITFKDVTRGS
VTLMWDAPILDGGARIHHYVVEKREASRRSWQVVSEKCTRQIFKVTDLLEGVPHYFRVSA
ENEYGIGEPYEMPEPIVATEEPAPPKRLDIIDTSKSSAVLAWLKPDHDGGSRITSYLLEM
RQKGSDFWVEAGHTKQLTFTVEHLVENTEYEFRVKAKNDAGYSEPREAFCSVIIKEPQIE
PTADLSGITNQIITCKAGSSFTIDIPISGRPAPKVTWKLEEMRLKDTDRMSIKTTKDRTT
LSVKESMRGDSGCYYLTLENTAGVKTFTVTVIVIGRPGPVTGPIEVSSVSAESCVLSWAE
PKDDGGTEITNYIVEKRESGTTAWQLVNSSVKRTQIKVTHLTKYMEYSFRISSENRFGVS
KPLESAPIVAEHPFVPPSAPTRPEVYFVSANAMAIRWEEPYHDGGSKIIGYWVEKKERNT
ILWVKENKVPCLECNFKITGLVEGLEYQFRTYALNAAGVSKASEASRPIVAQNPVDPPGR
PEVTDVTRSTVSLSWSAPIYDGGSKVIGYIVERKPVSEVGDGRWLKCNYTIVSENFFTVT
ALSEGDTYEFRVLAKNAAGVISKGSESTGPITCRDEYSKAELDARLQGDIVTIRAGSDLV
LDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTSKRATAVIKFCDRSDSGKYTLTVKNAS
GTKTVSVIVKVLDSPGPCGNLTISRVTEEKCTLAWTLPKEDGGAEITHYIVERRETSRLN
WVIVEGECPTLSYVVTRLIKNNEYIFRVRAVNKYGPGVPVESGPIIARNSFTIPSPPGMP
EEMGAGKEHVIIQWQKPESDGGNEISNYLVDKREKKSLRWTRVNKDYTVYDTRLKVTGLM
EGCEYQFRVTAVNAAGNSEPSEASNFILCKEPSYTPGPPSAPRVVDTTKRSISLAWTKPM
YDGGADIIGYVLEMKEQETDQWYRVHTNATLRNSEFTVPDLKTGQKYCFRVAAVNVNGMS
EYSESTTEIEPVERLVLPTIDLSTMPQKTIHVPAGRPIELVIPIAGRPPPAASWFFSGSK
LKESERVTFETHSKVTKLTIRETTIKDTGEYTLELKNVTGTTSETIKVIILDKPGPPTGP
IKIDEIDATSVTISWEPPELDGGAPLSGYVVEQRDAHRPGWLPVSESVTRPTFKFTRLTE
GNEYVFRVAATNRFGIGSYLQSTVELDVADVPDPPRGVKVSDVSRDSVNLTWTEPASDGG
SKITNYIIEKCATTAERWLRVGQARETRYTVINLFGKTSYQFRVIAENKFGLSKP
Download sequence
Identical sequences F6W8A2
ENSMODP00000012695 13616.ENSMODP00000012695 ENSMODP00000012695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]