SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012837 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012837
Domain Number 1 Region: 427-621
Classification Level Classification E-value
Superfamily Fibronectin type III 1.5e-41
Family Fibronectin type III 0.00099
Further Details:      
 
Domain Number 2 Region: 749-944
Classification Level Classification E-value
Superfamily Fibronectin type III 5.94e-39
Family Fibronectin type III 0.00061
Further Details:      
 
Domain Number 3 Region: 333-429
Classification Level Classification E-value
Superfamily Immunoglobulin 7.01e-23
Family I set domains 0.0025
Further Details:      
 
Domain Number 4 Region: 145-232
Classification Level Classification E-value
Superfamily Immunoglobulin 5.7e-22
Family I set domains 0.047
Further Details:      
 
Domain Number 5 Region: 244-337
Classification Level Classification E-value
Superfamily Immunoglobulin 1.94e-16
Family I set domains 0.015
Further Details:      
 
Domain Number 6 Region: 629-727
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000477
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 7 Region: 42-136
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000314
Family I set domains 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012837   Gene: ENSMODG00000010244   Transcript: ENSMODT00000013072
Sequence length 1271
Comment pep:novel chromosome:BROADO5:1:151313842:151364330:-1 gene:ENSMODG00000010244 transcript:ENSMODT00000013072 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARGDARRSLWVLSLTFCALSVHGKQLLSQETSLELGCGVGPLHVTLGPEQAVVLNCNPV
PSPSGPPARVTWNKDGSPIQEKKHLHLLPNGSLWVSQAAPQESRDGGAPEALEDNEGNYS
CLAHSPLGVVASQAAVIRFSTLSQFSLHPEPQTVEENGTARFECRIEGLPAPVITWEKDQ
MAVPSEPRLITLPNGVLQIVDVQESDAGTYHCVATNTAHQRYSHDAVLVVHKGSLFPPSV
GDVTIVAAPENTTVVAGQSVVMECMASADPTPFVSWIRQDGKPISTDVIVLGRTNLLITH
TQPHHSGVYVCRANKPRTRHFVTAAAELRVLASPVISQAPETISRTRASTARFVCRAEGE
PVPTLHWLRNGEPLLSNGRVKIQAGGGSLVITQIGLEDAGYYQCVAKNRLGTACATARLA
VIVREGLPSAPTRVAATPLTSTSVLVSWERPELHSEQIIGFSLHYQKALGTDNVEYQFAV
NNDTTEMQVRDLDPNTDYEFYVVAYSQLGASRTSAPALVHTLDDVPSAAPQLSLSSTTPG
DIRVTWLPLAPSLSNGKVVKYKIDYCTLREDQVFSTEVSGNETQLMLYSLQPNKVYRVRI
TAGTSAGYGAPSQWTQHRTPNTENQTHIPFAPSDLKVKARMESLVVTWQPPPHPIQISGY
KLYWREVGAEETSEERSSGGGSRGDQVWDVGPVRLKKKVKQYELTQLAPGRLYEVKLVAF
NKHEDGYAAVWKGKTERAPAADPPVQKSPPLPPAHVHAESNSSTSIWLRWKKPDFTTVKI
VNYTVRFSPWGLRNASLVTYYTSSGEDILIGGLKPFTKYEFAVQSHGVGVDGPFGSVVER
STLPDRPSTPPSDLRLSPLTPSTVRLRWCPPVEPNGVIVEYLILYSSNHSKPDHLWTLLT
TDGNIFSVEVHGLESDTRYFFKMGARTEVGPGPFSGLQDVLTLQEKLSDVLDVHSVTGII
VGVCLGLLCLLACMCAGLRNNSHREALPGLASPTAENPRLYSRAQLGPPGPPAAHELESL
VCPHPRLQDGSLSPFPDLDEGAEVHSLMGGGIEGRGHTKRKVTWAQSGGLSWSGTWAGCG
TPQTGTNPALTQALLPPAGAGQTLLLQALMYDAMMSDGRKKPLSACRNQVEADVIVHSDF
SASEGHHGPELYGPEPRDPTPPRSPASPSNSSELGLEADWPSGDLGGDELEATGQGLDRQ
THQPEAASVQGLCNGFPQRGDALEKVAPEHTDTYRGGQLIKGSPTLSGQADGLQGGSSGL
LSSTTTQSLWP
Download sequence
Identical sequences F6W6M8
ENSMODP00000012837 ENSMODP00000012837 XP_007479651.1.35504 XP_016283732.1.35504 XP_016283733.1.35504 XP_016283734.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]