SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012875 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012875
Domain Number 1 Region: 418-599
Classification Level Classification E-value
Superfamily Fibronectin type III 3.92e-36
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 2 Region: 324-419
Classification Level Classification E-value
Superfamily Immunoglobulin 1.4e-26
Family I set domains 0.0063
Further Details:      
 
Domain Number 3 Region: 233-324
Classification Level Classification E-value
Superfamily Immunoglobulin 1.51e-17
Family I set domains 0.0041
Further Details:      
 
Domain Number 4 Region: 136-224
Classification Level Classification E-value
Superfamily Immunoglobulin 2.8e-17
Family I set domains 0.015
Further Details:      
 
Domain Number 5 Region: 39-128
Classification Level Classification E-value
Superfamily Immunoglobulin 9.96e-16
Family I set domains 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012875   Gene: ENSMODG00000010271   Transcript: ENSMODT00000013110
Sequence length 785
Comment pep:novel chromosome:BROADO5:1:151235723:151304895:-1 gene:ENSMODG00000010271 transcript:ENSMODT00000013110 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPRPALLRPRFWLLLLRLLLLQLVLGSDLGHATELAFTVEPSDEIVVPERSVVLGCRA
EGTPPIRVTWRKNGVELPESSHALVLANGSLLLPSFRPDRGTGPSDEGDYDCVAQNRFGL
VVSRKARIQAATMSDFHVHPQATVGEEGGVARFQCQIHGLPKPLILWEKNHIPIDTRNDR
YTLLPKGVLQITGLRAEDSGIFHCVASNIASVRVSRGASLTVSGSGSGAYKEPTILVGPE
NLTLTVHQTAVLECVATGNPRPIVSWSRLDGRPIGVEGIQVLGTGNLIISDVTVQHSGVY
VCAANRPGTRVRRTAQGRLVVQAPAEFIQHPQSISRPAGTTAMFTCQAQGEPPPHVTWLK
NGQVLGPGGHVRLRNNNSTLTISGIGPEDEAIYQCVAENSAGSSQASARLTVLWAEGLPG
PPRDVHAVSVSATSVRVSWSEPLLNTKEIIGYVLHIRKAADPPELEYQEAVSKSTFQQLV
SDLEPSTSYSFYIKAYTPRGASLASVPTLVSTLGEVPAPPPLSIRVLSSNSVQLLWELPP
KLTHAEGGFKLFYRPASQALFTGPIVLPGALTAYNITQLDPTEVYEVKLQAYNQHGDGNA
TIRFVSLRGASERTALSPPCDCRKDETSNKTSATGIIIGIHIGVTCIIFCVLFLMFGYRG
RLLQCKDVEDQLSPPQGPRSQRDLGILALNGMAQGDRGQINGDEKRLDLNELEQLFPLSL
GSGQQGARLMLDPGSPEPCDETQLSSLPPDELSVLEEQMAETSCLAAGTPAHRDEVTSPS
PSNEG
Download sequence
Identical sequences F6VPD3
XP_001375672.1.35504 ENSMODP00000012875 ENSMODP00000012875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]