SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013153 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013153
Domain Number 1 Region: 30-76
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000124
Family HkH motif-containing C2H2 finger 0.0057
Further Details:      
 
Domain Number 2 Region: 103-147
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000199
Family HkH motif-containing C2H2 finger 0.023
Further Details:      
 
Domain Number 3 Region: 156-196
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000146
Family Plant C2H2 finger (QALGGH zinc finger) 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013153   Gene: ENSMODG00000010499   Transcript: ENSMODT00000013395
Sequence length 199
Comment pep:novel chromosome:BROADO5:1:575616996:575864324:-1 gene:ENSMODG00000010499 transcript:ENSMODT00000013395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQSRKHASKVRLYYMLHPVDGGCPAKKLRSENGSDDDMVDKNKCCTLCNMSFTSAVVADS
HYQGKIHAKRLKLLLGEQPPVKAAETPLSPLKPPHSASAPGVPVSSPHRRRDSDRYCQLC
AAWFNNPLMAQQHYEGKKHKKNAARVDLLEQLGKTLDLGELRGLRRSYTCSICHVTLNSI
EQYHAHLKGSKHQTKYVLS
Download sequence
Identical sequences F7EAE5
ENSMODP00000013153 ENSMODP00000013153 13616.ENSMODP00000013153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]