SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013176 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013176
Domain Number 1 Region: 110-332
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.36e-61
Family Ankyrin repeat 0.00014
Further Details:      
 
Domain Number 2 Region: 6-108
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000209
Family Fibronectin type III 0.00000178
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013176   Gene: ENSMODG00000010518   Transcript: ENSMODT00000013418
Sequence length 346
Comment pep:novel chromosome:BROADO5:1:27005724:27081563:1 gene:ENSMODG00000010518 transcript:ENSMODT00000013418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSQTIVPASKPHPPVVGKVTHHSIELYWDLDKKIQRKGPQEQWLRFSIEEEDPKMHTYG
IIYTGYATKHTVEGLEPRTLYKFRLKVTNPSGEYYYSPVVSVSTTREPISSEHFHRAVNV
NDEDLLVRILQGGHVKVDVPNKFGFTALMVAAQKGYIRLVKILIGNGTDVNMKNGSGKDS
LMLACYAGHLDVVKYLRAHGASWDARDLGGCTALHWAADGGHSNIIEWMIKDGCQIDVLD
TGSGWTPLMRVSAISGNKEVASLLIEAGADVNMKDKDGKTPLMVAVLNNHEELVQLLLEK
GADPSVKNEFGKGVLEMARVFDRQNVIALLEDQKGILSLKKTSYLS
Download sequence
Identical sequences F7DR54
ENSMODP00000013176 ENSMODP00000013176 XP_007478294.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]