SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013275 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013275
Domain Number 1 Region: 26-209
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 6.77e-79
Family MHC antigen-recognition domain 0.000000339
Further Details:      
 
Domain Number 2 Region: 214-303
Classification Level Classification E-value
Superfamily Immunoglobulin 1.38e-28
Family C1 set domains (antibody constant domain-like) 0.0000951
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013275   Gene: ENSMODG00000010596   Transcript: ENSMODT00000013518
Sequence length 355
Comment pep:novel chromosome:BROADO5:2:269726330:269728881:-1 gene:ENSMODG00000010596 transcript:ENSMODT00000013518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGTMKPSLLSLFVLGVVALTETRAGSHSMRYFHTAMSRPELGDSQFITVGYVDDQQFVRF
DSSSESQRMEPRAAWMDKMDEEEPNYWEEQTQIYRKNAQIYRRNLETLRGYYNQSQGGLH
TIQRMYGCEVHPDGSFRKGFYQLAYDGRDYIALHRETLTWTAADPGAENTKRKWEAERSI
AERYKAYLEETCLQWLKKYLQMGKDVLLRTDPPSARVSRHSGPDGEVSLRCRAQGFYPAE
ISLTWLRDGEEQLQDTEFIETRPGGDGTFQKWAAVAMAPGQEDRYSCRVQHEALAQPLSL
RWGTPSSGLSLLFPSSEPEASSLWVIVGVTAGVLALVTAVVAGAVILRRRNSGRE
Download sequence
Identical sequences F7G8H1
ENSMODP00000013275 ENSMODP00000013275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]