SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013279 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013279
Domain Number 1 Region: 14-106
Classification Level Classification E-value
Superfamily Immunoglobulin 2.15e-23
Family I set domains 0.0021
Further Details:      
 
Domain Number 2 Region: 107-200
Classification Level Classification E-value
Superfamily Immunoglobulin 2.51e-18
Family I set domains 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013279   Gene: ENSMODG00000010599   Transcript: ENSMODT00000013522
Sequence length 233
Comment pep:novel chromosome:BROADO5:2:269812699:269814665:-1 gene:ENSMODG00000010599 transcript:ENSMODT00000013522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YSLKFFSFLGKDFYPKPTLSAKPGPVLAPGGNLTLWCQVPVPATRFILNKVGEVQPVQIQ
ESSEFGAEFLFERVTPTHGGSYSCCYQTSYNEWSQPSDSVEVWVTDMLPKPWLIAMPGPV
VVPGTNVSLRCHGPLGGMSFALYRVGFPGPLQYLSSAQPWADFSLQDFMAPGTYSCYYHT
PFAPYILSKRSDPLIISWSGSTPQDYTTGNLIRMGLAGLVLLTLGTLVFLDWN
Download sequence
Identical sequences F7G8G1
ENSMODP00000013279 ENSMODP00000013279 13616.ENSMODP00000013279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]