SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013315 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013315
Domain Number 1 Region: 141-229
Classification Level Classification E-value
Superfamily Immunoglobulin 3.07e-17
Family I set domains 0.023
Further Details:      
 
Domain Number 2 Region: 53-138
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000578
Family I set domains 0.013
Further Details:      
 
Domain Number 3 Region: 226-322
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000271
Family I set domains 0.038
Further Details:      
 
Domain Number 4 Region: 4-57
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000539
Family C2 set domains 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013315   Gene: ENSMODG00000010631   Transcript: ENSMODT00000013560
Sequence length 591
Comment pep:novel chromosome:BROADO5:2:168478824:168492152:-1 gene:ENSMODG00000010631 transcript:ENSMODT00000013560 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTTEVLKDGKRETTISQLLIYPTDLDIGRIFTCRSTNEAIPGGKETSIELNVHHPPTVT
LSIQPQTVQEGERVVFTCQATANPEIQGYRWAKGGILIEDAHESRYETKVDYSFFTEPVS
CEVHNDVGSTNVSTLVDVHFAPRIVVDPKPTTTDIGSDVTITCVWAGNPPLTLTWTKKDS
NMVLSNSNQLYLKSVTQADAGIYTCRAIVPRIGVAEREVALVVNGPPIISSEAVQYAVRG
DGGKVECFIGSTPAPDRIAWAWKENFLEMGTLERYTVERTNSGSGVLSTLTINNVMEADF
QTHYNCTAWNSFGPGTAIITLEEKEVLPVGIIAGATIGAGILLVLFFTALIFFLYRRRKG
SRKDVTLRKLDIKVETVNREPLPLHPDREDDTASVSTATRVMKAIYSSFKDDVDLKQDLR
CDTIDTREEYEMKDPTNGYYNVRAHEDRPSSRAVLYADYRAPGPARFDARPSSRLSHASG
YAQLSTYSRGPAPDYGPEPSAPGPPPPGSGEQASQLSYENYEKFGPHPFPGAANYPTYRL
GYPQPPPPGLERTPYEAYDPIGKYATATRFSYTSQHSDYGQRFQQRMQTHV
Download sequence
Identical sequences F7DP18
ENSMODP00000013315 ENSMODP00000013315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]