SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013318 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013318
Domain Number 1 Region: 288-376
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000716
Family I set domains 0.029
Further Details:      
 
Domain Number 2 Region: 99-170
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000466
Family I set domains 0.009
Further Details:      
 
Domain Number 3 Region: 187-271
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000794
Family I set domains 0.035
Further Details:      
 
Domain Number 4 Region: 19-94
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000363
Family I set domains 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013318   Gene: ENSMODG00000010633   Transcript: ENSMODT00000013563
Sequence length 424
Comment pep:novel chromosome:BROADO5:2:168701678:168713960:-1 gene:ENSMODG00000010633 transcript:ENSMODT00000013563 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSHSSYAVIFPHPVTAKKAIVHLSPPWTTIFQGEKVTLTCDGFNSSIPRTWWYKNEQRQ
KTRSTKSIVIQQPGMYRCQNQDSTLSDPVHLVVSSDPLILQTPYSVFEGDTLTLKCRGRY
AERIRNITYYKDGKILSYFLKTSVFVIPQVGLSHSAQYHCTATTDLLQIFQQEISSRKVA
LQIQELFPPPELKVTSYQPIEGTPIALSCDTQLPPQKSDTELHFTFFRDGRTITSDWMRS
RVLQIPAIWREDSGSYSCEARAVAQDIRKQSKGVKINVKRIPISGILMKIQPSGGQVTEG
EKVVLICSAAQGTGNITFSWNREGIHSSLGEKTGRSLEEKFVLSDVNKNDAGKYYCTADN
SISSISSQMTDVIVISRNLPPQFNSREKIRPLALGLIVIQFIMVGLCASALLFFFGPWSK
LGNC
Download sequence
Identical sequences F7D544
ENSMODP00000013318 XP_007481802.1.35504 ENSMODP00000013318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]