SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013386 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013386
Domain Number 1 Region: 24-128
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000635
Family I set domains 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013386   Gene: ENSMODG00000010683   Transcript: ENSMODT00000013631
Sequence length 210
Comment pep:novel chromosome:BROADO5:3:326812361:326840614:-1 gene:ENSMODG00000010683 transcript:ENSMODT00000013631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSILRLLVLSCAWCLVPATLIVETTCSGNVSLPCTALWDPQTPYTTIFWEKINARGGELT
KMLGVNQSLSEHFHYEKEINGSLEACPPEKCSLNIRNITCQNAGIYRCTLQAPGEENSPS
DIVFLKVAGCTMEHEDDKFKKYRAEILLLLVLAMFYVFLIVFTCKFAKLQNIFPDVNKQG
MERTFLHIPFQNKKGTHQMGPATVQKMDLV
Download sequence
Identical sequences F7C160
ENSMODP00000013386 ENSMODP00000013386 13616.ENSMODP00000013386 XP_001376792.2.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]