SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013584 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013584
Domain Number 1 Region: 58-195
Classification Level Classification E-value
Superfamily L domain-like 4.48e-35
Family Ngr ectodomain-like 0.0033
Further Details:      
 
Domain Number 2 Region: 285-402
Classification Level Classification E-value
Superfamily Hormone receptor domain 1.2e-17
Family Hormone receptor domain 0.0068
Further Details:      
 
Domain Number 3 Region: 224-313
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000675
Family V set domains (antibody variable domain-like) 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013584   Gene: ENSMODG00000010848   Transcript: ENSMODT00000013833
Sequence length 1315
Comment pep:novel chromosome:BROADO5:1:572396449:572457410:1 gene:ENSMODG00000010848 transcript:ENSMODT00000013833 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALESGGAKGCPVPIRSCKCAGERPKGLSGGAPNPARRRVVCSGGDLPEPPEPGLLPNGTV
TLLLSNNKLTALRNGSFSGLPMLEKLDLKNNLISTVHPGAFLGLGELKRLDLSNNRIGCL
SSGAFQGLSNLLRLNMSGNIFSNLPAGVFDELPALKVVDFGTEFLTCDCRLRWVLPWARN
HSVQLSERTLCAYPSSLHAQALRGLQDTQLHCAGALELHTHHLIPSLRQVVFQGDRLPFQ
CTASYLGTSTRIHWYHNRVPVEGDEETGVILEESLVHDCTFITSELILSHIHVWASGEWE
CSVSTAQGNASKRVEIVVLETSASYCPAERVANNRGDFRWPRTLGGITAYQSCLQYPFTS
VPLSGGTPGTRASRRCDRTGRWEPGDYSHCLYTNDITRVLYTFVLMPINASNALTLAHQL
RVYTAEAAGFTDMMDVVYVAQMIQKFLGYVDQIKELVEVMVDMASNLMLVDEHLLWLAQR
EDKACSGIIEALERIGGAALSSHAQHISVNSRNVVLEAHLIKPHSYVGLSCTAYQKREPA
VSGQRPGPPGIDPQPEHETLADQQLRFRCTTGRPNISLSTFHIKNSVALASIQLPPSLFS
SPPAALAPPIPPDCTLQLLVFRNGRLFRSHGNTSRPGTTGPSKRRGVATPVIFAGTNGCG
VGNLTEPVAVSLRHWTEGVDPVAASWSMEGPGGPGGWSSEGCQLHSSQSNVSSLYCQHLG
NIAVLMELSTFRREAGGPGAVLHPVVYPCTALLLLCLFSTIITYILNHSSIHVSRKGWHM
LLNLCFHMAMTSAVFAGGITLTNYLIVCQAVGITLHYSSLSTLLWMGVKARVLYKELTWR
APPPQEGEPAAPTPRPMLRFYLIAGGIPLIICGITAAVNIHNYRDHNPYCWLVWRPSLGA
FYVPVALILLITWIYFLCAGLSLRGPQGQGPKGGHSRASLEPGEDLRCPARLQGSGPLLS
DSGSLLSAGGGRVISPGHPGHGDGIYSSGAQLGALVTTHFLYLALWACGALAVSQQWLPS
VVCSCLYGVVAVALGLFVFSHHCARRRDVRASWQACCPSSPPSPRALPRPLSTILEDGSA
VFAEGHSSLKSSPSGSSGHAPHSSPCKLTNLQLAQSQVCDVGVGALGEEPEATSPRGPAP
RHPNNVHHGRRGHKSRAKGHRAGDGGGKHRLKALRGGSAALTGASELQSSESGSLHNSPS
DSYPGSSRNSPGAGTGSGPCLREGEPALSPSEGSDTSGALGPEAGRTGQRRYASRDNLKG
GGGLLEESKRRSYPLNTASQNGALKAGKYDINLGSAESGAGGCMKTGLWKSETTV
Download sequence
Identical sequences F7ARJ5
ENSMODP00000013584 13616.ENSMODP00000013584 ENSMODP00000013584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]