SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013586 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013586
Domain Number 1 Region: 11-72
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000214
Family RING finger domain, C3HC4 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013586   Gene: ENSMODG00000010850   Transcript: ENSMODT00000013835
Sequence length 246
Comment pep:novel chromosome:BROADO5:3:199990816:200035811:-1 gene:ENSMODG00000010850 transcript:ENSMODT00000013835 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAETLSTATSYTEDDFYCPVCQEVFKTPVRTAACQHVFCRKCFLTAMRESGIHCPLCRGN
VTRRERACPERALDIENVMRKFSGSCRCCAKQIKFYRMRHHYKSCKKYQDEYGVSSIIPN
FQISQDSVGNRHKGLSLSFRGEILVQKEKSCSTGHPTFKCPLCQEANFTRQRLLDHCNNS
HLFQIVPVTCPICVSLPWGDPSQITRNFVSHLNQRHQFDYGEFVNLQLDEETQYQTAVEE
SYQVNF
Download sequence
Identical sequences F7ARI2
13616.ENSMODP00000013586 ENSMODP00000013586 ENSMODP00000013586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]